KEGG   Symbiobacterium thermophilum: STH1949Help
Entry
STH1949           CDS       T00196                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sth01100  Metabolic pathways
sth01110  Biosynthesis of secondary metabolites
sth01130  Biosynthesis of antibiotics
sth01230  Biosynthesis of amino acids
Module
sth_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STH1949
Enzymes [BR:sth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     STH1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin AAA AAA_22 AAA_16 CoaE AAA_17 AAA_5 AAA_28 dNK PQQ_2
Motif
Other DBs
NCBI-ProteinID: BAD40934
UniProt: Q67N09
LinkDB All DBs
Position
complement(2090299..2090823)
Genome map
AA seq 174 aa AA seqDB search
MNIVLVGLMGSGKTAVGRLLAERLGRPFVDTDRLVEADAGRTVADIFAAEGEEGFRRREA
EVVARAAAGDNQVIATGGGAVLRTENREALRRTGFVIWLDAEPETLYDRARGQGLHRRPL
LSGPDPLGRLRALAAARRPFYAQAAHVRICTDRRSLQDVVAEIMEKLQERGERG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcgttctcgtgggactcatgggatccggcaagacggctgtgggccggctcctg
gccgagcggctgggccggcccttcgtggacacggacaggctcgtggaggcggacgccggc
cgcaccgtcgccgacatcttcgccgcagagggcgaggaggggttccgccgccgggaggcg
gaggtggtggcgcgggcggccgccggcgacaaccaggtgatcgcgaccgggggcggcgcc
gtgctgcggacggagaaccgggaggcgctgcgccgcacggggttcgtgatctggctggat
gcggagccggaaacgctgtatgaccgggcccgcgggcaggggctgcaccgccggccgctg
ctcagcggccctgatccgctggggcggctgcgggcgctggcggccgcgcgccggccgttc
tacgcccaggccgcccacgtgcggatctgtacggaccgtcgttcgctgcaggacgtcgtg
gcagagatcatggaaaagctacaggaaaggggagagcgcgggtga

DBGET integrated database retrieval system