KEGG   Symbiobacterium thermophilum: STH205Help
Entry
STH205            CDS       T00196                                 

Definition
(GenBank) putative superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sth  Symbiobacterium thermophilum
Brite
Enzymes [BR:sth01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STH205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAD39190
UniProt: Q67T03
LinkDB All DBs
Position
230830..231768
Genome map
AA seq 312 aa AA seqDB search
MFGFDPYDSYALVCQHIADWARQARTAIACLKPEGGAADDLSGWQERFEALEREAQAALR
ADRSASGRPDAAALMRRAYEALTEFVRAAAGRGVPPAGELSPPRPVPPGGHRLPPLPYPY
DALEPYIDAETMRLHHDRHHRSYVEGLNRAERALAEARAAGDWALVKHWERELAFNGAGH
YLHTLFWESMAPGAGGEPGGEVLAQIRQDFGDFRRFREQFSKAAENVEGGGWAVWVWAPR
ANRTEILTAEKHQNLSQWDVVPLLPLDVWEHAYYLKYRNDRAAYIEQWWNVVNWPAVERR
LREARRIAWEPT
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgttcggcttcgatccctacgattcctacgcgctggtctgccagcacatcgccgactgg
gcccgccaggcgcgcacggcgatcgcgtgcctgaagccggagggcggagcggcagacgac
ctgagcggctggcaggagcggttcgaggcgctggagcgggaggcgcaggcggccctgcgg
gccgaccggtccgcaagcgggcgcccggacgcggcggctctgatgcggcgcgcgtatgaa
gcgctgacggagttcgtacgcgccgccgcaggccggggggtgccgccggcgggggagctg
tccccgccgcgcccggtgccgccgggcggccatcggctgccgccgctgccgtacccgtac
gacgcgctggagccgtacatcgacgcggagacgatgcggctccatcacgaccggcaccac
cggagctacgtggaggggctcaaccgggcggagcgggccctcgccgaggcgcgcgccgcg
ggcgactgggccctcgtgaaacactgggaacgggaactggccttcaacggcgcaggccac
tacctgcacacgctcttctgggagagcatggcgccgggcgccggcggtgagcccggcggc
gaggtgctggcgcagatccgacaggacttcggggacttcaggcggttccgggagcagttc
agcaaggccgccgagaacgtggagggagggggctgggccgtctgggtctgggccccccgg
gcgaaccgcacggagatcctgacggcggagaagcaccagaatctgagccagtgggacgtc
gttcccctcctgcccctcgacgtctgggagcacgcctactacctgaagtatcggaatgac
cgcgccgcgtacatcgagcagtggtggaacgtggtcaactggccggcggtggagcggagg
ctgcgggaggcgcgccggatcgcctgggagccgacgtag

DBGET integrated database retrieval system