KEGG   Symbiobacterium thermophilum: STH2821Help
Entry
STH2821           CDS       T00196                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00970  Aminoacyl-tRNA biosynthesis
sth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sth00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STH2821
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sth03029]
    STH2821
Enzymes [BR:sth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     STH2821
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     STH2821
Mitochondrial biogenesis [BR:sth03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    STH2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAD41806
UniProt: Q67KJ2
LinkDB All DBs
Position
complement(3035926..3037392)
Genome map
AA seq 488 aa AA seqDB search
MLSAARLNRLFLAGELSAVEIAESALSRIAQVEPAVGAFITVAADHVIERAKKLDARRKA
GDTELGPLAGVPIAVKDNICTSGMETTCASRILKGYVSPFDATVVERLRAAGAMIIGKAN
MDEFAMGSSGESSAFGVTRNPWDLERVPGGSSSGSAAAVAAGEAPLALGTDTGGSIRQPA
AFTGIVGLKPTYGYVSRYGVVAFASSLDQVGPMGRDVEDVARLFEVIAGPDRRDATNAGR
TPPALKFGGEPSLSGVRLGVPKELLGPGIDPGVKARVEEAIAQLEELGATVEECSLPSTE
YALSAYYVIAVAEASSNLARFDGVRYGYRAAQAGGLHEMYSKTRGEGFGTEVKRRIMLGT
YVLSAGHYDAYYRRAQQVRTLVVRDFERAFERYDALVTPTTPFTAWKIGEKVDDPVSMYL
GDICTIPVNLAGLPAVSVPCGFVDGLPVGMQLIGKPFADTQILQIAWAYQKVTKHHEARP
ALTEEGGR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcgcggcccggctcaaccggctctttctggccggggagctgtcggcggtggaa
attgcggaatctgccctgagccgcatcgcacaggttgaacccgcggtgggcgcgttcatc
acggtggcggccgatcacgtgatcgagcgggcgaagaagctggacgcgcgccgcaaggcc
ggcgacacggagctgggcccgctggccggcgtgccgatcgcggtgaaggataacatctgc
accagcgggatggagaccacctgcgcctcccgcatcctgaaggggtacgtctcgcccttc
gacgcgacggtggtggagcggctgcgtgccgccggcgcgatgatcatcggcaaggcgaac
atggacgagttcgcgatgggctcctcgggcgaatcctctgcgttcggcgtgacccgcaac
ccgtgggacctggagcgcgtgcccggcggctcatcctccgggtcggccgcggcggtcgcg
gccggggaggcccctctcgccctgggcacggacacgggcggctccatccggcagccggcc
gcattcaccggcatcgtcgggctgaagcccacctacgggtacgtcagccgctacggcgtg
gtcgcgttcgcctcgtcgctggaccaggtgggtccgatgggccgcgatgtggaggacgtg
gcccggctcttcgaggtgatcgccggacccgaccggcgcgacgcgaccaacgccgggcgc
accccgccggcgctgaagttcggcggcgaaccgtccctcagcggcgtgcgcctcggcgtg
ccgaaggagctgctcggccccggcatcgaccccggtgtgaaggcccgggtcgaggaggcc
attgcccagttggaggagctcggcgcgaccgtggaggagtgctcgctgccctccaccgag
tacgcgctgtcggcgtactacgtcatcgcggtcgccgaggcctcttcaaacctggcccgg
ttcgacggcgtgcggtacggctaccgcgccgcccaggccggcgggttgcacgagatgtac
agcaagacccgcggcgagggcttcggcacggaagtgaagcgccgcatcatgctgggcacc
tacgtcctctccgcaggccattacgacgcctactaccggcgggcgcagcaggtacgcacc
ctggtcgtgcgcgacttcgagcgcgcctttgagcggtacgacgccctggtgacccccacc
acgccgttcaccgcctggaagatcggggagaaggtcgacgacccggtctccatgtacctg
ggcgatatctgcaccattccggtcaacctggcggggctgccggccgtctccgtcccctgc
gggttcgtggacggcctgccggtcgggatgcagctgatcggcaagccctttgccgacacc
cagatcctgcagatcgcctgggcgtaccagaaggtgaccaagcatcacgaggcccgtccg
gccctgactgaggaaggaggtcggtag

DBGET integrated database retrieval system