KEGG   Streptococcus thermophilus ASCC 1275: T303_06185Help
Entry
T303_06185        CDS       T03360                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sthe  Streptococcus thermophilus ASCC 1275
Pathway
sthe00010  Glycolysis / Gluconeogenesis
sthe00020  Citrate cycle (TCA cycle)
sthe00620  Pyruvate metabolism
sthe01100  Metabolic pathways
sthe01110  Biosynthesis of secondary metabolites
sthe01120  Microbial metabolism in diverse environments
sthe01130  Biosynthesis of antibiotics
sthe01200  Carbon metabolism
Module
sthe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T303_06185
   00020 Citrate cycle (TCA cycle)
    T303_06185
   00620 Pyruvate metabolism
    T303_06185
Enzymes [BR:sthe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     T303_06185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 IF3_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: AIC24469
LinkDB All DBs
Position
complement(1138253..1139641)
Genome map
AA seq 462 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGEIVPVTEVIGYIGAEGEVVADNAAIAPAAEAAPQVEKVADVETPAAKPQPQVAIVH
EGGKIRATPKARKVAREMGIDLAQVLGTGAKGRIHADDVENFKGAQPKATPLARKIAADL
GIDLATVSGTGFGGKITKEDILAISAPAQVKVAAAAPAVEAKPEKVLPEGVEVIPMSAMR
KAISKGMTHSYLTAPTFTLNYDVDMTNLIALRKQVLDPIMNKTGMKVTFTDLIGLAVVRT
LMKEEHRYLNASLINDAQNIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQAGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGE
VVVRPIMGLCLTIDHRIVDGMNGAKFMVDLKHLLENPMELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagattattatgcctaagctcggtgtagacatgcaggaaggtgaaatcatc
gagtggaaaaaacaagagggagacgtggttaacgagggagatatccttcttgaaatcatg
tcagataagacaaacatggaacttgaagcagaagactcaggtgttcttttgaagattacc
cgtcaagctggtgaaatagtaccagttactgaggtgattggttatatcggagctgaagga
gaagttgtggctgataatgctgcaatcgcaccagctgcagaagctgcgccacaagttgaa
aaagttgctgatgtggaaacgcctgctgctaagcctcagccacaagtagctattgttcat
gaaggtggcaaaatacgcgcgacacctaaagcacgtaaagtggcacgtgagatggggatt
gacctcgctcaagttctcggaactggggcaaaagggcgtattcatgcagatgatgttgag
aactttaagggcgctcaacctaaggcaacaccattggctcgcaagattgcagcagacctc
ggtattgatttagctaccgtatctggaacaggatttggtggtaagattactaaggaagat
attcttgcaatcagtgctccagcacaagttaaggtggctgcagccgcacctgcggttgaa
gctaaacctgaaaaagtcttgccagaaggtgtggaagtcattccgatgtctgctatgcgt
aaggctatttctaagggaatgacgcactcatacttgactgcaccaacatttactcttaac
tatgatgtggacatgactaaccttatagctcttcgtaagcaagttcttgatccaatcatg
aataagactggtatgaaggtgaccttcactgatttgattggtttggcagttgtgcgtacc
cttatgaaagaggaacaccgttacctcaatgcatccttgattaatgatgcacaaaatatc
gaattacacaaatttgttaatcttggtattgcagttggtctagatgatggcttggttgta
ccagtcgttcatggtgctgataagatgagtttgtctgactttgtggtggcctctaaggat
gtcatcaaaaaagctcaggctggtaaattgaaggcggcagaaatgtcaggttctactttc
tctattactaacttgggaatgtttggaaccaagtcattcaatccaatcattaatcaacct
aactcagctatccttggtgtttcagcaactattcaaacaccggttgttgttgatggtgaa
gttgtcgtgcggccaatcatgggtctttgcttgactattgaccaccgtattgttgatggt
atgaatggtgctaaattcatggttgatttaaagcatttgcttgaaaatccaatggaattg
ttgatttaa

DBGET integrated database retrieval system