KEGG   Streptococcus thermophilus S9: AVT04_06440Help
Entry
AVT04_06440       CDS       T04785                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sths  Streptococcus thermophilus S9
Pathway
sths00473  D-Alanine metabolism
sths01100  Metabolic pathways
sths01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sths00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AVT04_06440
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AVT04_06440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sths01011]
    AVT04_06440
Enzymes [BR:sths01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AVT04_06440
Peptidoglycan biosynthesis and degradation proteins [BR:sths01011]
 Precursor biosynthesis
  Racemase
   AVT04_06440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALX91435
UniProt: A0A2U2MDD5
LinkDB All DBs
Position
1185406..1186509
Genome map
AA seq 367 aa AA seqDB search
MISSLHRPTLAKVDLSAISENIEQVVSHIPKQVQTFAVVKANAYGHGAVEVAKHVSKQVD
GFCVSNLDEALELRQAGIEQPILILGVVLPDGVPLAIQENISLTVASLEWLALAQKQGLD
LTGLTCHIKVDSGMGRIGVRNLKDADNLIAGLKALGADVEGIFTHFATADEADDSKFKRQ
LSFFTDLVDNLTARPRLVHASNSATSIWHATTVFNTVRLGVVIYGLNPSGSVLELPYNIQ
PALSLETALIHVKTLPAGQEVGYGATYTTTAEEVIGTLPIGYADGWTRDLQGFHVIVDGQ
LCPIVGRVSMDQITVRLPKVYPLGTPVTLMGENGGASITATEVAEKRGTINYEVLCLLSD
RVPRSYD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgagtttacatcgaccaaccttggcaaaggttgatctgtcagcaatttcagaa
aatattgaacaagtggttagtcatattcctaaacaggtgcagacttttgcagttgtaaag
gccaatgcttatggtcatggcgctgttgaagtggctaaacatgtgtctaagcaggtggat
ggtttttgtgtttctaacctagatgaggcgcttgaacttcgtcaagctggcatagagcaa
ccgatacttattttgggagtagtcttgccagatggtgttcccttggctattcaagaaaac
attagtctgacggtggcctcacttgagtggttggcactggctcagaaacaagggcttgat
ttgacaggtttgacctgtcatattaaggttgattcaggtatgggtcgtattggggtacgt
aacctaaaggacgcagataacttgattgctggtctgaaggctcttggtgctgatgtcgaa
ggtatttttactcattttgcaacagctgatgaagcagatgatagtaaatttaagcgtcaa
ttatctttcttcaccgatttggtggataacttgactgctagacctcgcttggtgcacgct
agcaactcagcgacaagtatttggcatgcaacaaccgtctttaatacggtacgtctgggt
gttgtcatctatggtctcaatcctagtggcagtgtcttggaacttccctataatattcaa
cctgccctaagtttagagacagctcttattcatgttaagacccttccagccggtcaagaa
gtgggttacggtgcaacctatacaactacggctgaagaagttattggaacgcttccaatt
ggctatgcggatggttggactagagatttacaaggtttccatgttattgtggatggacaa
ctttgtcctattgttgggcgtgtgtctatggaccagatcactgttcgccttcctaaggtt
tatccactaggaactccagttacgcttatgggtgaaaatggaggagcgagcattactgcg
acagaggtggctgaaaagcgtggcacaatcaactacgaggtcctttgtttacttagtgat
cgtgtacctcgtagctatgactaa

DBGET integrated database retrieval system