KEGG   Streptococcus thermophilus S9: AVT04_06840Help
Entry
AVT04_06840       CDS       T04785                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sths  Streptococcus thermophilus S9
Pathway
sths00220  Arginine biosynthesis
sths00250  Alanine, aspartate and glutamate metabolism
sths00290  Valine, leucine and isoleucine biosynthesis
sths01100  Metabolic pathways
sths01110  Biosynthesis of secondary metabolites
sths01130  Biosynthesis of antibiotics
sths01210  2-Oxocarboxylic acid metabolism
sths01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sths00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AVT04_06840
   00290 Valine, leucine and isoleucine biosynthesis
    AVT04_06840
   00220 Arginine biosynthesis
    AVT04_06840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sths01007]
    AVT04_06840
Enzymes [BR:sths01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AVT04_06840
    2.6.1.66  valine---pyruvate transaminase
     AVT04_06840
Amino acid related enzymes [BR:sths01007]
 Aminotransferase (transaminase)
  Class I
   AVT04_06840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALX91502
LinkDB All DBs
Position
1271237..1272451
Genome map
AA seq 404 aa AA seqDB search
MKTFDKSSKLEHVAYDIRGPVLDEANRMIAKGEKILRLNTGNPAEFGFTAPDEVIRDLIM
NVRNSEGYSDSKGIFSARKAIMQYCQLKGFPNVDIDDIYIGNGVSEMIPMSMQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYVCDEKSNWYPDIDDIKSKITSNTKAIVIINPNNP
TGALYPKDVLEQIVDIARQNDLIIFADEIYDRLVMDGKKHIAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKKNVRGYIEGLDMLSNMRLCSNVLSQHVIQTSLGGYQSVDELL
IPGGRIYEQREFITNTVNDIPGLTAVKPDAGLYIFPKIDRNMYDIDDDEEFCLRLLKKEK
VLLVPGKGFNWNEPDHFRIVYLPRVEELADLGNKIERVLLYYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttgataaatcatcaaagttggaacacgttgcctatgatattcgtggtcca
gttttggatgaggccaaccgtatgattgccaaaggcgaaaaaattctccgtctgaacaca
ggaaatcctgcggaatttggttttacagcaccagatgaagtcattcgtgacttaattatg
aatgttcgtaacagtgagggatattcagatagtaaggggattttctcagctcgtaaggct
attatgcagtattgccagcttaagggtttcccaaatgtagacatcgatgatatctatatt
ggtaacggtgtgtcagagatgattcccatgtctatgcaggccttgcttgatgatggtgat
gaagtcttggttccaatgccagactatcctctttggacagcttgtgtcagtctagctggc
ggtaacgctgttcactatgtctgtgatgaaaaatctaactggtatccagacattgatgat
atcaaatcaaagattacatcaaatactaaggctattgttattatcaatccgaataacccg
acaggtgctctttaccctaaagatgttcttgaacagattgtcgatattgcacgccaaaat
gatttgattatctttgcggatgagatttatgaccgcttggttatggatggtaagaagcac
attgctattgcaagtcttgcaccagacgttttctgtgtatctatgaatggtctttctaaa
tctcaccgtatttgtggtttccgtgtaggttggatggttctttctgggcctaagaagaat
gttcggggctatattgaagggcttgatatgttgtccaatatgcgcctttgctctaatgtg
ctctctcaacacgtaattcagacctcacttgggggctaccaatctgttgatgagctcctg
attccaggtggtcgtatttatgaacaacgtgagtttattacaaacacagtaaacgatatt
ccaggactcacagctgttaagccagatgcgggtctttacatcttccctaagattgaccgc
aacatgtatgatattgacgatgatgaagagttctgtcttcgtcttttgaagaaggaaaag
gtcctcttggttccaggtaaaggctttaactggaatgaaccggaccacttccgtattgtc
taccttcctcgtgtggaagaattggctgatcttggaaataaaatcgagcgtgttttgtta
tattataagcgctaa

DBGET integrated database retrieval system