KEGG   Streptococcus thermophilus S9: AVT04_07100Help
Entry
AVT04_07100       CDS       T04785                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sths  Streptococcus thermophilus S9
Pathway
sths00473  D-Alanine metabolism
sths00550  Peptidoglycan biosynthesis
sths01100  Metabolic pathways
sths01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sths00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AVT04_07100
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AVT04_07100
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AVT04_07100
Enzymes [BR:sths01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AVT04_07100
Peptidoglycan biosynthesis and degradation proteins [BR:sths01011]
 Precursor biosynthesis
  Amino acid ligase
   AVT04_07100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK MsyB GARS_A
Motif
Other DBs
NCBI-ProteinID: ALX91548
LinkDB All DBs
Position
1319344..1320390
Genome map
AA seq 348 aa AA seqDB search
MSKQTLILLYGGRSAEREVSVLSAESVMRAVDYNAFEVKTYFITQSGDFIKTQEFIETPG
DDEKLMTNDTVEASQAIKPSDIYEEDAVVFPVLHGPMGEDGSIQGFLETLKLPYVGTNVL
SSSVAMDKIMTKRILEVAGVPQVAYTVYIEGEDLEAAVAETLEKLTFPVFVKPANMGSSV
GISKAENESELRSAIDLALKYDSRILIEQGVVAREIEVGILGNTTVKTTDPGEVVKDVAF
YDYQAKYIDNKITMDIPARVPVEVMTQMRAYAAKAFRALGGCGLARCDFFLTEDGAIYLN
ELNTMPGFTQWSMYPLLWENMGLSYSDLIKELVVLGQEMFDKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaacccttatccttctctatggtggacgttcagcagaacgtgaagtgtct
gtactatcagctgagagtgttatgcgtgcggtagattacaacgcatttgaggttaaaacc
tactttatcactcagtctggtgattttatcaaaacacaagaatttatagaaaccccaggt
gatgatgagaagctcatgactaatgacactgttgaggctagtcaggctattaaaccaagc
gatatctacgaagaagatgctgtggtcttccctgtgcttcatggtcctatgggtgaggat
ggttctatccaaggtttccttgaaaccctcaagttgccatacgtggggaccaatgttctt
tcatcaagtgtagctatggacaagattatgaccaagcgtattcttgaagttgctggagtg
ccacaggttgcctacacagtctacatcgagggtgaagatttggaagcagcagtagcagag
acacttgaaaaattgaccttcccagtttttgtcaaaccagccaacatggggtcatctgtt
gggatttctaaagctgaaaatgaatcagagcttcgttcagcgattgatcttgctctcaaa
tatgatagccgtatcttgattgagcaaggtgtagttgctcgtgaaatcgaagttggtatc
cttggaaatacgactgtcaaaacgactgatccgggtgaagtggtcaaagacgtggctttc
tatgattaccaagccaagtacattgacaataagattaccatggatattccagctcgcgtg
cctgtcgaagtcatgacgcaaatgcgtgcctatgcggccaaggcctttcgtgctctaggg
ggttgcggtcttgcccgctgtgatttcttcctgacagaggatggagccatctaccttaat
gagctcaacaccatgccaggtttcactcaatggtcaatgtacccactactttgggaaaat
atgggactctcttactcagatcttatcaaggaattggtagttttgggacaagaaatgttc
gacaaacgtgaaagccatttgatttaa

DBGET integrated database retrieval system