KEGG   Streptococcus thermophilus S9: AVT04_07305Help
Entry
AVT04_07305       CDS       T04785                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sths  Streptococcus thermophilus S9
Pathway
sths00500  Starch and sucrose metabolism
sths01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sths00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AVT04_07305
Enzymes [BR:sths01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AVT04_07305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ALX91589
UniProt: A0A0P6UK52
LinkDB All DBs
Position
complement(1361546..1362997)
Genome map
AA seq 483 aa AA seqDB search
MTNQTAMQYFEWYLPSDGQHWNNLAEDAQHLADLGISHVWMPPAFKATNKDDVGYGVYDL
FDLGEFDQKGTIRTKYGLKEEYLNAINQLKNVGIIPMADVVLNHKAAADKLETFYVVEVD
PEDRTKVISEPFEIEGWTHFTFDGRQKAYNDFEWHWYHFNGTDFDAKRNKKGIYLIQGDN
KGWAHNDLVDNENGNFDYLMFANLDYRHPEVIENIYEWADWFVETTGVQGFRMDAIKHID
YFFMRNFIRDVKEKQGQDFYVFGEFWNAKEEDNNTYLEKTENRFDLVDVRLHYNLYDASL
KGADYDLTTIFEQTLVKNHPEHAVTFVENHDTQRGQALESTVEEWFKPSAYALILLRKDG
LPCLFYGDYYGIDGEFAQESFKEVLDTLLYARKDLAYGEQTDYFDDPNCIGWTRSGNEDC
TPLAVTISNDAANNKSMEIGSDWAGQTFYDILGNCSDTVTIDEDGWGDFPVSEKSVSVWT
IQD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaactgcaatgcaatactttgaatggtatctcccaagtgacggccaacat
tggaacaacttagctgaagatgcccaacatctagcagaccttggcatcagccatgtttgg
atgccacctgctttcaaagctactaacaaagatgatgttggttacggagtctatgacctc
tttgaccttggggaattcgaccaaaaaggaaccatacgcaccaaatatggtctcaaggaa
gaataccttaatgccatcaaccaactcaaaaatgttggtatcatccctatggccgatgtt
gtgctcaaccacaaggcagccgcggataaacttgaaaccttttatgtggtagaagttgac
cctgaggaccgtaccaaagtaatcagcgaaccgtttgaaatcgagggttggactcatttc
acttttgacggacgtcagaaagcttacaacgactttgaatggcactggtaccactttaat
gggactgacttcgatgccaaaagaaataaaaaaggtatctatcttatccaaggtgacaac
aaaggctgggcacataatgacttggttgacaatgaaaatggtaactttgactaccttatg
tttgccaacctagattataggcatcctgaagttatagaaaatatttacgaatgggctgac
tggttcgtcgaaacaactggtgtccaaggtttccgaatggatgccatcaagcacattgat
tatttctttatgcgtaattttattcgcgatgtcaaagaaaaacaaggtcaagatttctat
gtttttggtgaattttggaatgccaaggaagaggataataatacttatctcgaaaaaact
gaaaaccgctttgatcttgtggatgttcgccttcattacaatttatatgatgccagcctc
aaaggagcagattacgatttgacgactattttcgaacaaacattggtcaaaaatcaccct
gagcatgcggtaaccttcgtagagaaccatgacacccaacgtggacaagcattggaatct
actgttgaagaatggtttaaaccatctgcctatgccctcatccttcttcgtaaagacggc
cttccttgcctattttatggtgactactatggcattgatggtgagtttgctcaagaaagt
ttcaaagaggtcctagacaccttactctacgctcgtaaagatttggcttatggagagcaa
acagactactttgacgaccctaactgtattggatggacacgctctggtaatgaagactgt
actccattagctgtaaccatttctaatgatgctgccaacaacaaatctatggaaattgga
agtgattgggctggacaaactttctatgatattcttggaaactgctctgatactgtaaca
attgacgaagacgggtggggagacttcccagtctctgaaaaatctgtcagcgtttggaca
attcaagactaa

DBGET integrated database retrieval system