KEGG   Streptococcus thermophilus S9: AVT04_09445Help
Entry
AVT04_09445       CDS       T04785                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sths  Streptococcus thermophilus S9
Pathway
sths00010  Glycolysis / Gluconeogenesis
sths00020  Citrate cycle (TCA cycle)
sths00620  Pyruvate metabolism
sths01100  Metabolic pathways
sths01110  Biosynthesis of secondary metabolites
sths01120  Microbial metabolism in diverse environments
sths01130  Biosynthesis of antibiotics
sths01200  Carbon metabolism
Module
sths_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sths00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AVT04_09445
   00020 Citrate cycle (TCA cycle)
    AVT04_09445
   00620 Pyruvate metabolism
    AVT04_09445
Enzymes [BR:sths01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AVT04_09445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 IF3_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: ALX91969
LinkDB All DBs
Position
1778169..1779557
Genome map
AA seq 462 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGEIVPVTEVIGYIGAEGEVVADNAAIAPAAEAAPQVEKVADVETPAAKPQPQVAIVH
EGGKIRATPKARKVAREMGIDLAQVLGTGAKGRIHADDVENFKGAQPKATPLARKIAADL
GIDLATVSGTGFGGKITKEDILAISAPAQVKVAAAAPAVEAKPEKVLPEGVEVIPMSAMR
KAISKGMTHSYLTAPTFTLNYDVDMTNLIALRKQVLDPIMNKTGMKVTFTDLIGLAVVRT
LMKEEHRYLNASLINDAQNIELHKFVNLGIAVGLDDGLVVPVIHGADKMSLSDFVGASKD
VIKKAQAGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGE
VVVRPIMGLCLTIDHRIVDGMNGAKFMVDLKHLLENPMELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagattattatgcctaagctcggtgtagacatgcaggaaggtgaaatcatc
gagtggaaaaaacaagagggagacgtggttaacgagggagatatccttcttgaaatcatg
tcagataagacaaacatggaacttgaagcagaagactcaggtgttcttttgaagattacc
cgtcaagctggtgaaatagtaccagttactgaggtgattggttatatcggagctgaagga
gaagttgtggctgataatgctgcaatcgcaccagctgcagaagctgcgccacaagttgaa
aaagttgctgatgtggaaacgcctgctgctaagcctcagccacaagtagctattgttcat
gaaggtggcaaaatacgcgcgacacctaaagcacgtaaagtggcacgtgagatggggatt
gacctcgctcaagttctcggaactggggcaaaagggcgtattcatgcagatgatgttgag
aactttaagggcgctcaacctaaggcaacaccattggctcgcaagattgcagcagacctc
ggtattgatttagctaccgtatctggaacaggatttggtggtaagattactaaggaagat
attcttgcaatcagtgctccagcacaagttaaggtggctgcagccgcacctgcggttgaa
gctaaacctgaaaaagtcttgccagaaggtgtggaagtcattccgatgtctgctatgcgt
aaggctatctctaagggaatgacgcactcatacttgactgcaccaacatttactcttaac
tatgatgtggacatgactaaccttatagctcttcgtaagcaagttcttgatccaatcatg
aataagactggtatgaaggtgaccttcactgatttgattggtttggcagttgtgcgtacc
cttatgaaagaggaacaccgttacctcaatgcatccttgattaatgatgcacaaaatatc
gaattacacaaatttgttaatcttggtattgcagttggtctagatgatggcttggttgta
ccagtcattcatggtgctgataagatgagtttgtctgactttgtgggggcctctaaggat
gtcatcaaaaaagctcaggctggtaaattgaaagcggcagaaatgtcaggttctactttc
tctattactaacttgggaatgtttggaaccaagtcattcaatccaatcattaatcaaccg
aactcagctatccttggtgtttcagcaactattcaaacaccggttgttgttgatggtgaa
gttgttgtgcggccaatcatgggtctttgcttgactattgaccaccgtattgttgatggt
atgaatggtgctaaattcatggttgatttaaagcatttgcttgaaaatccaatggaattg
ttgatttaa

DBGET integrated database retrieval system