KEGG   Sphaerobacter thermophilus: Sthe_0092Help
Entry
Sthe_0092         CDS       T01128                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
sti  Sphaerobacter thermophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like PUCC MFS_3
Motif
Other DBs
NCBI-ProteinID: ACZ37531
UniProt: D1C5L5
LinkDB All DBs
Position
1:97518..98738
Genome map
AA seq 406 aa AA seqDB search
MTSEHRRLVLSVYIPTLLLSFGQGVMIPVLPVYATRLGGDYGLAGVVVAAAWIGTTLFDM
PTGLLLPRIGYRRAMLLGAGVFAAATTALGLAEAIPALIILRFLAGVGTAFWGLSRHAFI
TQAVPPAARGRVISVFGGINRLGHFTGPAVGGLIGKLYGLPTALIVSGALAGMAFVLAVV
FVRDLPGTAPASRHGLDLSVLREAVAGNHRNVVAAGTAQIFGQMIRASRQIVIPLYANSL
GLDDFQVGQIVSASSLVDVLLFVPAGIVMDRFGRKAAAVPSFTIMGLGMALVPFTETYWT
LMAAALLLGFGNGIGSGTMMTLGADLAPPGRTGEFLGIWRFIGDTGQAIAPLAVGQLANL
IGLALTAGATAGLGLLAAGTLTFFVRETHQARAAGRTGLARPAKRA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggagcaccgccggttggtcctgtcggtctatatccccaccctgctcctgtcc
ttcggccagggcgtcatgattccagtgctcccggtctacgccacgcgccttggcggcgac
tatggcctggctggtgtggtcgtcgccgccgcctggatcggcaccacgctcttcgatatg
ccgactgggttgctgctgccccgcatcggctaccgacgcgcgatgctcctgggggctggc
gtgtttgcggccgccacgaccgcgctcggacttgccgaggcgatcccggcgttgatcatc
cttcgcttcctcgccggcgtgggaactgcgttctggggcctctcccgccatgccttcatc
acgcaggcagtccccccggcggcgcgcggacgggtcatctcggtcttcggggggatcaac
cggcttggccacttcaccgggcccgccgtcggaggtctgatcggcaagctgtacggcctg
ccgacggcgctgatcgtgtccggggcgctggccgggatggcgttcgtgctcgcggtcgtc
ttcgtccgtgatctgcctggaaccgccccggcttcccggcatggcttggacctctccgtg
ctgcgcgaggcggtagccgggaaccaccggaacgtcgtcgccgcggggacggctcagatc
ttcgggcagatgatccgggcctcgcggcagatcgtcatcccgctctatgccaactccctc
gggctcgacgactttcaggtcggtcagatcgtgagtgcctcgtcgctggtcgatgtactc
ctcttcgtgccggccgggatcgtgatggaccgcttcgggcgcaaggcggcggcggtgccg
tccttcaccatcatgggcctcggcatggcgctcgttcccttcaccgagacgtactggacc
ctgatggccgccgcgctgctgctcggtttcggcaatgggattggctccggcacgatgatg
acgcttggcgccgatctcgcgcccccggggcgcacgggggagttcctcggcatctggcgc
ttcatcggggataccggacaagcgatcgcgccgctggccgtggggcagcttgccaacctg
atcggcctggcgctcaccgccggagctaccgcggggctgggcctgctcgccgccggaacc
ttgaccttcttcgttcgcgagacgcaccaggcacgcgcggcgggtcggaccggtctggcc
cgaccggccaaacgcgcgtga

DBGET integrated database retrieval system