KEGG   Sphaerobacter thermophilus: Sthe_0314Help
Entry
Sthe_0314         CDS       T01128                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sti  Sphaerobacter thermophilus
Brite
KEGG Orthology (KO) [BR:sti00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Sthe_0314
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sti03400]
    Sthe_0314
Enzymes [BR:sti01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Sthe_0314
DNA repair and recombination proteins [BR:sti03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Sthe_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACZ37753
UniProt: D1C6Z2
LinkDB All DBs
Position
1:complement(352609..353514)
Genome map
AA seq 301 aa AA seqDB search
MSGEQADIQVLQVDGREIVVTSPDKVLWPQDGLTKTDLLDYYQAVAPAMLPYLRDHPVTL
RVFPGGIDRPGHYRRDLPKDAPDWLPSATYSPASRAGELHPPLIPDAAALLWYAERGAIE
FHIWLATADRLEQPDWAVFDLDPGDEVDFPAVLDAALLVRDTLAAQGIDGYPKTSGGRGL
HVFVPLEPVHDFAAVRDWVRGIAAQLAEEHPDQIAVAARGTHEGQRVTVDHAQNSVARNT
AAPYTARGHPGAPVSAPVTWDEVAAGTIRPDQFTLRTMPERIQQLGDLWAPALNAPQRLP
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcaggcagacatccaggtgctccaggtcgacgggcgcgagatcgtcgtc
accagcccggacaaggtcctgtggccgcaggacgggctgaccaagaccgacctgctcgac
tactaccaggccgtggccccggccatgctgccctacctccgcgatcatccggtgaccctg
cgcgtcttccccggcgggatcgatcgaccgggccactaccgccgcgacctgccgaaggac
gcacctgattggctgccgagtgcgacctacagcccggcgtcacgcgccggggagctgcac
ccgccgctaatcccggacgcggcggctctgctctggtacgcggagcgcggcgcgatcgag
tttcatatttggcttgcgaccgcagaccgcctggaacagccggactgggccgtgttcgac
ctcgacccgggcgacgaggtggacttccccgcggtgctggacgctgcgctgctggtccgc
gacacgctggcggcgcaaggcatcgacggctacccaaagaccagcggcgggcggggactg
cacgtcttcgtcccgctcgaacccgtccacgacttcgcggcggtgcgcgactgggtgcgg
ggcatcgccgcccagttggccgaggagcacccggaccagatcgcggtcgccgcccgcggg
acacacgaggggcagcgcgtgaccgtcgaccacgcacagaacagcgtcgcgcgcaacacg
gcggcgccctataccgcgcgcgggcatccaggggccccggtctccgcgccggtcacctgg
gacgaggtagccgccggcacgatacggccagaccagttcaccctgcgcaccatgcccgaa
cggatccagcagctcggcgatctctgggcccccgccctgaacgcgccccagcgcctgcca
ggctga

DBGET integrated database retrieval system