KEGG   Sphaerobacter thermophilus: Sthe_0364Help
Entry
Sthe_0364         CDS       T01128                                 

Definition
(GenBank) phosphate ABC transporter, ATPase subunit
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sti00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Sthe_0364
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sti02000]
    Sthe_0364
Enzymes [BR:sti01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Sthe_0364
Transporters [BR:sti02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Sthe_0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_30 AAA_29 AAA_22 ABC_ATPase AAA_16 AAA_23 RsgA_GTPase AAA_15 AAA_18 AAA_33 AAA_27 AAA_28 MMR_HSR1 AAA_25 Rad17 PRK DUF3987 Adeno_IVa2 NACHT AAA_24 cobW IstB_IS21 AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: ACZ37803
UniProt: D1C742
LinkDB All DBs
Position
1:complement(403333..404151)
Genome map
AA seq 272 aa AA seqDB search
MATTPPTAPAIRMPPTSEAHLVLEGLTLRYGARIAVAPTTLTIPRHRVTAIIGPSGAGKS
TLLRALNRLHEKVPGAGVDGRVLLDGEDIYGLGVDPILLRRRVGMVFQQPNPLLTRSIAE
NVSIGLELVGMPRRERAATVEWALRRVALWDEVRDRLDHPATSLSGGQQQRLCIARTLAV
RPEVILMDEPASALDPIATSRIEDLIRELASEFTVVIVTHNMQQAARIADYTVFMTPNED
GAGEVVEAGPTEEIFTAPHNQRTEDYITGRFG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaccacaccgcccaccgcaccggcgattcgaatgccgcccacctcggaggcgcac
ctggtgttggaagggctcacgctgcgctacggcgcccgcatcgccgtcgcaccgaccacg
ctgaccatcccgcgccaccgggtgacggctatcatcgggccatcgggggcgggcaagtcg
accctgctgcgcgcgctgaaccgtctccacgagaaggtcccgggcgccggtgtcgacggc
cgcgtcctcctcgacggcgaggacatctacggccttggcgtcgacccgatcctcctccgg
cgcagggtcggtatggtgttccagcagcccaacccactgctcacccgctcgatcgccgag
aacgtgagcatcgggctcgaactcgtcggcatgccacgccgggagcgcgccgcgaccgtc
gagtgggcgctgcgtcgcgtggcgctctgggacgaggtccgcgaccggctggatcacccg
gccacctcgctctccggcgggcagcagcagcggctctgcatcgcccggaccctcgcggtc
cgccccgaggtgatcctgatggacgagccggccagcgcactcgacccgatcgccacctcc
cgcatcgaggacctgattcgtgagctggcgagcgagttcaccgtcgtcatcgtaacccac
aacatgcagcaggcggcccggatcgcggactacaccgtcttcatgacccccaacgaggac
ggcgccggcgaggtggtcgaggccgggccgacagaggagatcttcaccgcgccgcacaac
cagcgcaccgaggactacatcaccgggaggttcggctaa

DBGET integrated database retrieval system