KEGG   Sphaerobacter thermophilus: Sthe_0805Help
Entry
Sthe_0805         CDS       T01128                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:sti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sthe_0805
Enzymes [BR:sti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Sthe_0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ACZ38242
UniProt: D1C1X5
LinkDB All DBs
Position
1:890433..891911
Genome map
AA seq 492 aa AA seqDB search
MAQFKNFIGGKWVDSRSGEEFERTNPATGELIGTFPKSTEEDVQAAVEAAREAFNRWRLY
PAPKRGEILYRVGQLLIERKEQLAREMTEEMGKVLTEARGDVQEGIDMTFYMAGEGRRLW
GQTTPSELPNKWNMSVRKPLGVVGVITPWNFPLAIPTWKIMPALIAGNTVVFKPASYTSR
MAVRLVEIFQEAGLPDGVINLVMGSGETVGNAILRHPDVALISFTGSTDTGTHVSVEGAR
LGKRVSLELGGKNAIIVMDDADIDLAVDGILWSAFGTSGQRCTAASRVIAHRAIQQELVE
KLAARAGGMRLGYGLEETTDIGPVVSASQLERVHSYVAIGQDEGAELVVGGKIARDGELA
RGHFHESTIFNNVKPTMRIAQEEIFGPVTAVIPVDGLDEAIEVANGVKYGLSAAIYTRDV
NKAFRAMQDIFTGILYVNAGTIGAEIHLPFGGTKATGNGHREAGQAALDVFTEWQSIYVD
YSGRLQRAQIDT
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagttcaagaacttcatcggtggcaagtgggtggactcacgcagcggcgaggag
ttcgaacgcaccaacccggccaccggtgagctgatcgggacgtttcccaagagcacggag
gaggacgttcaggctgcagtcgaggcggcgcgcgaagccttcaatcgctggcggctctac
ccggcgccgaagcggggtgagatcctctaccgggtcggccagctcctgatcgagcgtaag
gagcaacttgcccgggaaatgacggaggagatgggcaaggtcctcaccgaggcacgtggg
gacgtgcaggaaggcatcgacatgaccttctacatggcgggcgaaggtcgccgcctgtgg
ggtcagacgacgccgtccgagcttcccaacaagtggaacatgtcggtgcgcaagccgctc
ggcgtggtcggcgtgattaccccgtggaacttcccgctggcgatcccgacctggaagatc
atgcccgccctcatcgccgggaacaccgtcgtcttcaagcccgcgagctacacctcgcgc
atggccgtgcggctggtggagatcttccaggaggccggcctgcccgacggtgtgatcaac
ctggtcatgggcagcggcgagacagtcggtaatgccatcctgcgccatccggacgtcgcg
ctcatctccttcaccggctcgaccgacaccggcacccacgtctcggtcgaaggcgcacgc
ctgggcaagcgggtctcgctggagctgggcggcaagaacgcgattatcgtcatggacgac
gctgacatcgacctggcggtcgacgggatcctctggagcgccttcggcacctccggccag
cgctgcacggccgccagccgggtcatcgcccatcgcgcgatccagcaggagctggtcgag
aagttggccgcgcgtgccggcgggatgcgcctcggctacggcctggaggagacgaccgac
atcgggccggtggtcagcgcctcgcagctggagcgggtccactcctacgtcgccatcggc
caggacgagggggccgaactggtggtgggcggcaagatcgcccgcgacggtgagctggcc
cgcggccacttccacgagtcgacgatcttcaacaacgtcaagccgacgatgcgcatcgcg
caggaggagatcttcggcccggtcacggcggtcatcccggtggacggcctggatgaagcg
atcgaggtggccaacggcgtgaagtacgggctgtccgccgcgatctacacccgggacgtg
aacaaggcgttccgggcgatgcaggacatcttcaccggcatcctgtacgtcaacgccggg
acgatcggcgcggagatccacctgccgttcggcggcaccaaggcgaccggcaacggccac
cgcgaggccggccaggccgcgctggatgtgttcactgaatggcagagcatctacgtcgac
tacagcggccgcctgcagcgcgcgcagatagacacgtag

DBGET integrated database retrieval system