KEGG   Sphaerobacter thermophilus: Sthe_3385Help
Entry
Sthe_3385         CDS       T01128                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00010  Glycolysis / Gluconeogenesis
sti00071  Fatty acid degradation
sti00350  Tyrosine metabolism
sti00625  Chloroalkane and chloroalkene degradation
sti00626  Naphthalene degradation
sti00680  Methane metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01120  Microbial metabolism in diverse environments
sti01130  Biosynthesis of antibiotics
sti01200  Carbon metabolism
sti01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sthe_3385
  09102 Energy metabolism
   00680 Methane metabolism
    Sthe_3385
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sthe_3385
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Sthe_3385
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sthe_3385
   00626 Naphthalene degradation
    Sthe_3385
Enzymes [BR:sti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sthe_3385
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     Sthe_3385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACZ40785
UniProt: D1CAE2
LinkDB All DBs
Position
2:1089116..1090195
Genome map
AA seq 359 aa AA seqDB search
MRIKAAVLWERRTPLRVEDVEIADPAPGEARVKILASGVCHSDLHHIRRETAFVPPLVLG
HEGAGVVESVGEGVTRVQPGDRVIIAFGQKCGTCYFCLRGEHHLCAAPGPSNVRLRHGDQ
VLTPLLAVGSFAEYANVDARNLVKIPDEMPIDRAALIACGVTTGLGAVIKTARVEPGSNV
AVIGVGGVGLNVVQGAALAGATRVIAIDLVDRKLEMAREFGATHTINPNREDPIEAVRSL
TGGWGVDYAFEVIGHPATIRQAYDMTRKGGKAVVVGLADGADEVSIPAQDLMRSGKSLVG
CFYGSVSPYQDIPRYVDLYLNRRIKLDELISRRFALDEINEAIRALDAGEVARGVIVFE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcaaagcagcggtgttgtgggagcggcgcacgccgttgcgggtggaggatgtc
gagatcgcagacccggcgccgggtgaggcgcgggtcaagatcctggcgagtggcgtctgc
cactccgacctgcaccacatccgccgggagacggcgtttgtgccgccgctggtgctgggg
cacgagggtgctggcgtggtcgagtcggtcggcgagggcgtgacgcgcgtgcagcccggc
gaccgcgtcatcatcgccttcggccagaagtgcgggacgtgctacttctgcctgcgcggc
gagcaccacttgtgcgccgcgccggggccgagcaacgttcggctgcgacacggagaccag
gtgttgaccccgttgctggcggtcggcagcttcgccgagtacgccaacgtggacgcccgc
aacctggtgaagatccccgacgagatgccgatcgaccgcgccgcgctcatcgcctgcggg
gtgaccactggcctgggggcggtgatcaagacggcgcgggtggagcccggctcgaacgtg
gcggtaatcggcgtcggcggggtcgggttgaacgtcgtgcagggtgcagcgctggccggt
gcgacgcgggtcatcgccatcgatctcgtcgaccgcaaactggagatggcgcgcgagttc
ggcgcgacccacacgatcaatcccaatcgggaagacccgatcgaggcggtgcggagcctg
accggcggctggggcgtcgactacgccttcgaggtgatcgggcacccggccacgatccgg
caggcgtacgacatgacgcgcaagggcggcaaggcggtggtcgtcgggctggcggacggg
gccgacgaggtgtcgatcccggcccaggacctcatgcgctccgggaagtcgctggtgggc
tgcttctacgggtcggtgtcgccctatcaggacatcccgcgctacgtggacctgtatctg
aaccggcggatcaagctcgacgaactgatcagccgccgcttcgcgctcgacgagatcaac
gaggccatccgcgccctcgacgcgggcgaggtcgcgcgcggggtgatcgtgttcgagtga

DBGET integrated database retrieval system