KEGG   Streptococcus salivarius JIM8777: SALIVA_0092Help
Entry
SALIVA_0092       CDS       T02089                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase (alkyl hydroperoxide reductase)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
stj  Streptococcus salivarius JIM8777
Brite
KEGG Orthology (KO) [BR:stj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SALIVA_0092 (ahpF)
Enzymes [BR:stj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SALIVA_0092 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 HI0933_like DAO Thi4 AlaDh_PNT_C FAD_binding_3 NAD_binding_7 NAD_binding_8 Lycopene_cycl Glutaredoxin Thioredoxin_9 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CCB94456
LinkDB All DBs
Position
complement(79591..81123)
Genome map
AA seq 510 aa AA seqDB search
MVLDKEIKTQLAQYLNLLESDIVLQTDLGDDDNSRKVKEFLDEIAAMSDRISLESTHLKR
QPSFGIAQKGQKSRVIFSGLPMGHEFTSFILALLQVSGRPPKVDEDTIERIKKIDKPIDL
ETYVSLTCHNCPDVVQAFNIMAVLNPNITHTMIEGGMYQDEVKAKGIMSVPTVYKDQEEF
TSGRATIEQLVEKLDGPLDADAFADKGVYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVIETVGIENMIGTLYTEGPKLMAQVEEHTKSYDVDIIKSQLATGIEKKELIEVTLA
NGAVLKSKTAILALGAKWRNINVPGEEEFRNKGVTYCPHCDGPLFEGKNVAVIGGGNSGL
EAALDLAGITKHVTVLEFLPELKADQVLQERAAKTDNLTILKNVATKEIVGQNHVTGLNY
VERDTNEEKHLDLEGVFVQIGLVPSTAWLKDSGIELNERQEIIVDKFGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtcttagataaagaaatcaagacgcaattagcacaatatttaaatttactagaatct
gatattgtattacaaacggatttaggggatgacgataattctcgaaaagtaaaagaattt
ctagacgagattgccgctatgtctgaccgcattagtcttgaatcaacacatttaaaacgt
caacctagttttggtattgcacaaaaagggcaaaaaagtcgtgttattttctcaggctta
ccaatgggccacgaattcacatctttcatcttagctctcttgcaagtttctggtcgtcca
cctaaagttgatgaggacactatcgaacgtatcaagaagattgataaacccatcgattta
gaaacttatgtttcattaacatgtcacaattgtccagacgttgttcaagcctttaatata
atggctgttttgaacccaaatatcactcacaccatgattgaaggtggtatgtatcaggat
gaggtcaaagccaaaggtatcatgtctgttcctacagtttacaaagaccaagaagaattt
acatctggtcgtgcaaccattgaacagcttgtagaaaaattggacggaccacttgatgct
gatgctttcgctgataaaggtgtctatgatgttttggttattggtggtgggcctgctgga
aacagtgcggccatctatgctgcccgtaaaggtttaaaaactggtcttttagcagaaacc
tttggtggacaagttatcgagacagtcggcattgagaatatgattggtacgctatataca
gaaggtcctaagttaatggcccaagttgaggagcatacgaaatcttatgatgttgatatc
atcaaaagtcagttagctactggcatcgaaaagaaagaacttattgaagtgacactggct
aacggtgccgttttaaaatccaaaactgctatcctagctctcggagccaaatggcgtaat
atcaacgttcctggcgaggaagaattccgcaataaaggggttacttactgcccacactgc
gatggtccactatttgaaggaaagaatgttgcagttatcggtggtggtaactcaggtttg
gaagcggctttagatttagctggtatcactaaacatgttacggtcttagagttcttacct
gaattaaaggcagatcaagtcttacaagaacgagctgctaaaactgataatctaaccatt
cttaagaacgttgcaaccaaagaaattgttggtcaaaatcatgtaactggtttgaattac
gttgagcgtgatacaaacgaagaaaaacatcttgatcttgaaggtgtctttgttcaaatt
ggtcttgtaccaagtactgcttggctcaaagatagtggcattgaactcaatgagcgccaa
gaaattatcgttgataaatttggttcaacaaatatccctggtatttttgctgcaggtgac
tgtacagatagcgcctacaagcaaatcattatctccatggggtctggtgctacagctgct
attggagcctttgattacttgattagacaataa

DBGET integrated database retrieval system