KEGG   Streptococcus salivarius JIM8777: SALIVA_0587
Entry
SALIVA_0587       CDS       T02089                                 

Gene name
hmcM
Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00280  Valine, leucine and isoleucine degradation
stj00650  Butanoate metabolism
stj00900  Terpenoid backbone biosynthesis
stj01100  Metabolic pathways
stj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SALIVA_0587 (hmcM)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SALIVA_0587 (hmcM)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SALIVA_0587 (hmcM)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SALIVA_0587 (hmcM)
Enzymes [BR:stj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SALIVA_0587 (hmcM)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N ACP_syn_III_C
Other DBs
NCBI-ProteinID: CCB94918
LinkDB
Position
complement(594836..596005)
AA seq 389 aa
MSIGIDKIGFATSQYVLNMADLALARGAEPEKFSKGLMLDATSITPITEDIVTLASDAAA
DILNDDDKNAIDMVIVATESSIDQSKAAAVYVHSLLGIQPFARSFEMKEACYAATAGLNY
AKLHVATHPDSKVLVIASDIARYGVGSSGESTQGAGAVAMLVSQNPRILELADDNVAQTR
DVMDFWRPNYSSTPYVQGIYSTKQYLDSLKTTWVAYQERHQANFADFAAFCLHLPYPKLA
LKGLNKIIPKDLNPENKERLTNNFDASITYSRQIGNIYTGSLYLGLLSLLEQSQDLKAGD
KIGFFSYGSGAVSEIFSGRLVEGYKDLLRSDRLDTFAKRQQLSVADYEKLFYEEAQLDDT
GSTQFADYQTGAFRLAEISEHQRIYKKGH
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtctattggaattgataagattggttttgcgaccagtcaatatgttctaaacatggct
gatctcgctcttgcccgtggggcggagcctgaaaaattcagcaaggggctgatgcttgat
gcaaccagtattacgccgattacagaagatatcgtgacgcttgcctctgatgcggcggct
gatattttaaatgacgacgacaaaaatgctatcgatatggtcatcgtagctactgagtct
tccattgaccagtctaaggctgctgctgtctatgtccacagtcttttaggtattcagcct
tttgctcgttcttttgaaatgaaggaagcttgttacgctgcaactgctggacttaactat
gctaagttgcatgtggcaactcacccagatagcaaagttctggttatcgctagtgatatt
gcccgctatggtgtcggatcttctggggagtcaactcagggagctggtgctgtagctatg
ctagtcagtcagaatccacgtattttggaacttgctgatgataatgtggcacaaactcgt
gatgtcatggacttctggcgtccaaactacagttcaacgccttatgttcaaggcatctat
tcaaccaaacagtaccttgacagtttgaagacaacttgggtagcttatcaagaacgccat
caggctaactttgctgattttgctgctttttgtctccatcttccttatcctaagctagct
cttaagggacttaataagattattccaaaagatttgaatccagagaacaaagagcgtctg
acaaataacttcgatgcttcaattacctatagtcgtcaaattgggaatatctatacaggg
tcactctatcttggacttctttctttgcttgaacagtcgcaagaccttaaagccggagat
aagattggcttcttctcttacggttctggagctgtctctgaaattttctcaggacgtctg
gttgaaggttacaaagacctgcttcgttcggaccgcctagatacctttgccaaacgtcaa
caattaagcgttgctgattatgaaaaacttttctatgaggaggcgcagttggatgacact
ggttctactcaattcgctgattaccaaaccggagctttccgtttagctgaaatctctgaa
caccaacgtatctataaaaaaggacattaa

DBGET integrated database retrieval system