KEGG   Streptococcus salivarius JIM8777: SALIVA_0603
Entry
SALIVA_0603       CDS       T02089                                 

Gene name
ilvE
Definition
(GenBank) branched-chain-amino-acid aminotransferase (BCAT)
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00270  Cysteine and methionine metabolism
stj00280  Valine, leucine and isoleucine degradation
stj00290  Valine, leucine and isoleucine biosynthesis
stj00770  Pantothenate and CoA biosynthesis
stj01100  Metabolic pathways
stj01110  Biosynthesis of secondary metabolites
stj01210  2-Oxocarboxylic acid metabolism
stj01230  Biosynthesis of amino acids
stj01240  Biosynthesis of cofactors
Module
stj_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
stj_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SALIVA_0603 (ilvE)
   00280 Valine, leucine and isoleucine degradation
    SALIVA_0603 (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    SALIVA_0603 (ilvE)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SALIVA_0603 (ilvE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stj01007]
    SALIVA_0603 (ilvE)
Enzymes [BR:stj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SALIVA_0603 (ilvE)
Amino acid related enzymes [BR:stj01007]
 Aminotransferase (transaminase)
  Class IV
   SALIVA_0603 (ilvE)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-ProteinID: CCB94933
LinkDB
Position
610054..611076
AA seq 340 aa
MTVDLDWENLGFNYSKLPFRYISYYKDGKWDEGQLTEDATLHISEASPALHYGQEAFEGL
KAYRTKDGSIQLFRPDENAKRLQRTADRLLMPQVPVDKFVDACKQVVRANEEYVPPYGTG
ATLYLRPLLIGVGDIIGVHPADEYIFTIFAMPVGNYFKGGLAPTNFLIQDDYDRAAPHGT
GAAKVGGNYAASMLPGKIAHDRNFSDVIYLDPATHTKIEEVGSANFFGITADNEFVTPLS
PSILPSITKFSLLYLAENRFGMKAIQGDVKISELDKFVEAGACGTAAVISPIGGVQHGDD
FHVFYSETEVGPVTRKLYDELTGIQFGDVEAPEGWIVKVD
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgacagttgatttagactgggaaaatctaggatttaattacagtaaacttccattccgt
tatatctcatattacaaagacggtaaatgggatgaggggcaattgactgaggatgccact
ttgcatatttcagaagcatctccagcccttcactatggtcaagaagcttttgaaggactc
aaggcttaccgtactaaagatggctctattcaattgttccgtccagatgaaaatgctaaa
cgtttgcaacgtactgctgatcgtcttttgatgccacaagttcccgttgacaaatttgta
gatgcatgtaaacaagttgtacgtgcaaatgaagaatatgttccaccatatggtacaggt
gcaacactttatctccgtccattgttgattggggttggtgatatcattggtgtgcatcca
gcagatgagtatatctttaccatttttgctatgccagtaggtaactacttcaaaggtggt
ttggctccaacaaacttccttatccaagatgattatgaccgtgctgctccacatggtaca
ggtgctgctaaggttggtggtaactacgcagcaagtatgttgccaggtaagattgcacat
gatcgtaacttctctgatgtgatctaccttgatccagcaactcacactaagattgaagaa
gtgggttctgcaaacttctttggtatcacagccgataacgaattcgttacaccactcagc
ccatctatcttgccatctatcactaagttctcattgctttacttggctgaaaatcgcttt
ggcatgaaagctatccaaggtgatgttaagatttctgaattggataaatttgtcgaagca
ggtgcctgtggtacagctgccgttatttcaccaattggtggggtacaacatggtgatgac
ttccatgtcttctattcagaaacagaagtaggtcctgtaacacgtaaactttatgatgag
ttgacaggtatccaatttggtgatgttgaagcaccagaaggatggattgtcaaagttgac
taa

DBGET integrated database retrieval system