KEGG   Streptococcus salivarius JIM8777: SALIVA_1068Help
Entry
SALIVA_1068       CDS       T02089                                 

Definition
(GenBank) acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00010  Glycolysis / Gluconeogenesis
stj00020  Citrate cycle (TCA cycle)
stj00620  Pyruvate metabolism
stj01100  Metabolic pathways
stj01110  Biosynthesis of secondary metabolites
stj01120  Microbial metabolism in diverse environments
stj01130  Biosynthesis of antibiotics
stj01200  Carbon metabolism
Module
stj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVA_1068
   00020 Citrate cycle (TCA cycle)
    SALIVA_1068
   00620 Pyruvate metabolism
    SALIVA_1068
Enzymes [BR:stj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SALIVA_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CCB95383
LinkDB All DBs
Position
1079617..1081005
Genome map
AA seq 462 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGETVPVTEVIGYIGAEGEVVADNAASTPAAEPAPKVEEVAAVAEPVVAAQTQAPVVH
EGGKVRATPKARKVARELGIDLAQVPGTGAKGRVHADDVENFKGAQPKATPLARKIAADL
GIDLASVSGTGFGGKITKEDILAISAPAQVKEAASAPVVEAKPEKVLPEGVEVIPMSAMR
KAISKGMTHSYLTAPTFTLNYDVDMTNLMALRKQVLDPIMNKTGMKVTFTDLIGLAVVRT
LMKEEHRYLNASLIDDAQNIELHKFVNLGIAVGLDDGLIVPVVHGADKMSLSEFVVASKD
VIKKAQAGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGE
VVVRPIMGLCLTIDHRIVDGMNGAKFMVDLKHLIENPMELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagattattatgcctaagcttggtgttgatatgcaggaaggcgaaatcatc
gagtggaagaaacaagagggtgatgtggttaatgagggagatatccttcttgaaatcatg
tcagataaaacgaacatggaacttgaagcagaagattctggtgttcttttgaagattacc
cgtcaggctggagaaactgtaccagttactgaggtcattggttatattggagcagaaggt
gaagttgttgctgataacgcagctagcacaccagctgctgaaccagcgccaaaagttgaa
gaagttgccgctgtagcagagcctgtagtggcagcacaaacccaggcccctgtcgtacac
gaaggtggcaaagtacgtgcaacacctaaggctcgtaaggtggcgcgtgagttgggtatt
gacctcgctcaagttccaggaactggagcaaaaggtcgtgttcatgctgatgacgttgag
aactttaagggtgctcaacctaaggcgactccattggcacgtaagattgcagcggacctt
ggtattgacttagctagcgtatctggaacaggctttggtggtaagattactaaggaagac
atccttgcaatcagtgccccagcgcaagttaaggaagcggcttctgcacctgtagttgaa
gctaaacctgaaaaagtcttgccagaaggcgtggaagttatcccaatgtctgctatgcgt
aaggctatttctaagggaatgacgcactcatatttgactgcaccaacctttactcttaac
tatgacgtggacatgactaaccttatggctcttcgtaagcaagtccttgatccaatcatg
aataagacgggcatgaaggtaaccttcactgatttgattggtttggcagttgtgcgtact
cttatgaaggaggaacaccgttacctcaatgcatccttgattgacgatgcgcaaaatatc
gaattacacaaatttgttaatctcggtattgccgttggtctcgatgatggcttgattgta
cctgtcgttcacggtgcagataagatgagtttgtctgagttcgttgtggcttctaaggat
gtcatcaagaaggctcaagctggtaaattgaaggctgcagaaatgtcaggttcaactttc
tctattactaacttgggaatgtttggaactaagtcatttaacccaatcatcaaccaacca
aactcagctatccttggtgtttcagcaactattcaaactccagttgttgttgatggagaa
gttgtcgtacgaccaatcatgggtctatgcttgacaattgaccaccgtatcgtagatggt
atgaatggtgccaaattcatggttgatttgaaacatttgattgaaaatcctatggaattg
ttgatttaa

DBGET integrated database retrieval system