KEGG   Streptococcus salivarius JIM8777: SALIVA_1168
Entry
SALIVA_1168       CDS       T02089                                 

Gene name
aldB
Definition
(GenBank) alpha-acetolactate decarboxylase
  KO
K01575  acetolactate decarboxylase [EC:4.1.1.5]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00650  Butanoate metabolism
stj00660  C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SALIVA_1168 (aldB)
   00660 C5-Branched dibasic acid metabolism
    SALIVA_1168 (aldB)
Enzymes [BR:stj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.5  acetolactate decarboxylase
     SALIVA_1168 (aldB)
SSDB
Motif
Pfam: AAL_decarboxy Vps52
Other DBs
NCBI-ProteinID: CCB95482
LinkDB
Position
complement(1191139..1191858)
AA seq 239 aa
MSEAIKLFQYNTLGALMAGLYGGTLTVGELLEHGDLGLGTLDSIDGELIVLDGKAYQAKG
SEGKVEVVEVSPDEKVPYAAVVPHQAEVIFRQRYEMTDKELEDRIESYYDGVNLFRSIKI
KGHFKHMHVRMIPKSNADIKFADVATRQPEYEVDNISGTIVGIWTPEMFHGVSVAGYHLH
FISDDLTFGGHVMDFVIENGIIEVGPVDQLDQRFPVQDRQYLFAKFNVDEMREDITKAE
NT seq 720 nt   +upstreamnt  +downstreamnt
atgtctgaagccataaaattatttcaatataatactttgggagccttgatggctgggctt
tatggaggtactttaacagttggagaattgttggagcatggagacttgggtctcggaaca
ttagattctatcgatggtgagttgattgttcttgacggtaaagcctatcaagccaaaggg
tctgagggtaaggtcgaagtggtagaagtttctcctgatgaaaaagtaccttatgcagca
gtcgtacctcaccaagctgaagttatcttccgtcaacgttatgaaatgactgataaagag
cttgaggatcgtattgaatcttattatgatggggtcaatcttttccgttctatcaaaatc
aaaggtcattttaaacatatgcacgtgcgcatgattccaaaatcaaatgccgatattaag
tttgctgatgttgccacacgccaacctgagtacgaggtagataatatttcaggtactatc
gttggtatttggacgccagaaatgttccacggtgtgagtgttgctgggtatcacctccat
tttatttcagacgacttgacatttggtggtcacgttatggactttgttattgaaaatggt
attatcgaagttggtccagttgaccaactcgaccaacgtttcccagtgcaagaccgtcag
tatctttttgctaaattcaatgtcgatgagatgcgtgaagatattactaaggctgaataa

DBGET integrated database retrieval system