KEGG   Streptococcus salivarius JIM8777: SALIVA_1174
Entry
SALIVA_1174       CDS       T02089                                 

Gene name
butA
Definition
(GenBank) acetoin(diacetyl) reductase (AR) (Acetoin dehydrogenase) (Meso-2,3-butanediol dehydrogenase)
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SALIVA_1174 (butA)
Enzymes [BR:stj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     SALIVA_1174 (butA)
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     SALIVA_1174 (butA)
    1.1.1.-  
     SALIVA_1174 (butA)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N F420_oxidored NAD_binding_2 TrkA_N Epimerase
Other DBs
NCBI-ProteinID: CCB95488
LinkDB
Position
complement(1197852..1198616)
AA seq 254 aa
MSKVAIVTGAGQGIGFAIAKRLVEDGFKVGVLDYNAETAEKAVAELSADKAFAVVADVSK
QAEVAAAFQKVVDHFGDLNVVVNNAGVAPTTPLDTITEEQFQRTFNINVGGVIWGAQAAQ
AQFKTLGHGGKIINATSQAGVVGNPNLTVYGGTKFAVRGITQTLARDLADSGITVNAYAP
GIVKTPMMFDIAHEVGKNAGKDDEWGMQTFAKDITLKRLSEPEDVAAAVSFLAGPDSNYI
TGQTIIVDGGMQFH
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtcaaaagttgctattgttacaggtgcaggtcaaggtattggttttgcgattgcaaaa
cgtttggttgaagatggttttaaagtcggagtattggactacaatgctgaaactgcagaa
aaagcggttgctgaattgtcagcagataaagcatttgcagttgtagctgatgtatctaaa
caagctgaagtagcagctgctttccaaaaagttgttgatcactttggcgatttgaatgtt
gttgttaataatgccggtgtggctccaacaacacctcttgatacaattactgaagaacag
ttccaacgtacatttaatatcaatgtcggtggtgttatttggggtgctcaagctgcacaa
gcacaatttaaaacactcggtcatggtggtaaaatcatcaatgcaacatctcaggctggt
gtcgttggtaaccctaacttgactgtatatggtggtactaaatttgcagtgcgtggtatt
actcaaactttggcgcgtgatttggctgattcaggcatcactgtcaatgcttatgcacca
ggtatcgttaagactccaatgatgtttgacattgcccacgaagttggtaaaaatgctggt
aaagatgatgaatggggtatgcaaacttttgctaaagatattaccctcaaacgtttgtct
gaacctgaagacgtagcagcagcggttagcttccttgctggacctgactcaaactacatc
acaggtcaaacaatcatcgttgatggtggtatgcaattccattaa

DBGET integrated database retrieval system