KEGG   Streptococcus salivarius JIM8777: SALIVA_1939
Entry
SALIVA_1939       CDS       T02089                                 

Gene name
ilvC
Definition
(GenBank) Ketol-acid reductoisomerase (Acetohydroxy-acid isomeroreductase) (Alpha-keto-beta-hydroxylacil reductoisomerase)
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00290  Valine, leucine and isoleucine biosynthesis
stj00770  Pantothenate and CoA biosynthesis
stj01100  Metabolic pathways
stj01110  Biosynthesis of secondary metabolites
stj01210  2-Oxocarboxylic acid metabolism
stj01230  Biosynthesis of amino acids
Module
stj_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
stj_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SALIVA_1939 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SALIVA_1939 (ilvC)
Enzymes [BR:stj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     SALIVA_1939 (ilvC)
SSDB
Motif
Pfam: IlvN IlvC F420_oxidored 2-Hacid_dh_C AdoHcyase_NAD NAD_binding_2 ApbA NAD_Gly3P_dh_N CoA_binding TrkA_N
Other DBs
NCBI-ProteinID: CCB96234
LinkDB
Position
complement(2076246..2077268)
AA seq 340 aa
MAVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGHDVIIGVRPGKSFDKAKED
GFDTYTVAEATKLADIIMVLAPDEIQKDIYKDEIEPNLSAGKALGFAHGFNIHFEFIKVP
KDVDVFMVAPKGPGHLVRRTYTEGFGVPALYAVYQDATGNAKDIAMDWAKGIGSARVGLL
VTTFKEETEEDLFGEQAVLMGGLTHLIEAGFEVLTEAGYAPQLAYFEVLHEMKLIVDLIY
EGGFKKMRQSCSNTAEFGDFVTGPRVIGPEVKENMKAALADIQSGKFAREFVEDHDAGFP
RLKAYRKEAEELEIEKIGAELRKAMPFVGQNDDDAFKIYN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggcagttcaaatggaatatgaaaaagacgtaaaagtagcagcacttgacggtaaaaaa
atcgccgttatcggttacggttcacaaggtcatgcgcatgcacaaaacttgcgtgattca
ggtcacgatgtgatcatcggtgttcgtccaggtaaatcatttgataaagctaaagaagat
ggttttgatacttacacagtagcagaagcaactaaattggctgatatcattatggttttg
gcaccagatgaaattcaaaaagatatctataaagatgaaatcgagccaaacttgagtgca
ggcaaagctcttggttttgcacacggatttaatatccacttcgaattcatcaaggttcct
aaagatgttgatgtctttatggttgctcctaaaggaccaggtcacttggtacgccgtaca
tatacagaaggctttggtgttcctgcactttacgcagtataccaagatgctacaggtaac
gctaaagacatcgctatggactgggctaaaggtattggttctgcacgtgttggattactt
gtaacaacatttaaagaagaaactgaagaagatttgtttggtgaacaagcggttcttatg
ggtgggttgacacaccttattgaagctggttttgaagtcttgactgaagcaggctatgca
ccacaattagcttactttgaagtgcttcacgaaatgaaattgatcgttgacttgatctac
gaaggtggattcaagaaaatgcgtcaatcatgttcaaatactgcagaatttggtgacttt
gtaactggtccacgtgtcatcggtccagaagtcaaagaaaacatgaaagctgcccttgct
gatatccaatcaggtaaatttgcacgtgaattcgttgaagaccatgatgctggcttccca
cgtttgaaagcttaccgtaaagaagctgaagagcttgaaattgaaaagattggtgctgaa
ttgcgtaaagcaatgccattcgttggtcaaaacgacgatgacgcattcaaaatctataac
taa

DBGET integrated database retrieval system