KEGG   Streptococcus salivarius JIM8777: SALIVA_1949
Entry
SALIVA_1949       CDS       T02089                                 

Gene name
adhE
Definition
(GenBank) aldehyde-alcohol dehydrogenase 2 [Includes: Alcohol dehydrogenase (EC 1.1.1.1) (ADH); Acetaldehyde dehydrogenase (ACDH)]
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00010  Glycolysis / Gluconeogenesis
stj00350  Tyrosine metabolism
stj00620  Pyruvate metabolism
stj00625  Chloroalkane and chloroalkene degradation
stj00626  Naphthalene degradation
stj00650  Butanoate metabolism
stj01100  Metabolic pathways
stj01110  Biosynthesis of secondary metabolites
stj01120  Microbial metabolism in diverse environments
stj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVA_1949 (adhE)
   00620 Pyruvate metabolism
    SALIVA_1949 (adhE)
   00650 Butanoate metabolism
    SALIVA_1949 (adhE)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SALIVA_1949 (adhE)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SALIVA_1949 (adhE)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SALIVA_1949 (adhE)
   00626 Naphthalene degradation
    SALIVA_1949 (adhE)
Enzymes [BR:stj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SALIVA_1949 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SALIVA_1949 (adhE)
SSDB
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Other DBs
NCBI-ProteinID: CCB96244
LinkDB
Position
complement(2088682..2091270)
AA seq 862 aa
MTKQTKDVQTVIDELATKGVEALDAMANFTQEQVDHIVHQAAIAALDKHMYLAKLAVDET
GRGIYEDKAIKNMYASEYIWNSIKYDKTVGVIAEDKEQGLVSIAEPVGVICGVTPTTNPT
STTIFKALIALKTRNSIVFAFHPSAQKSSAEAARIVRDAAIEAGAPKDCIQWIEEPSIEA
TGLLMNHPKIATVLATGGPGMVKAAYSTGKPALGVGAGNVPSYIAADAKVKRAVNDIIVS
KTFDNGMICASEQAAIVDAAIYDEVKAEFEAHQCVIISKKADIAKLEKVVLNEARTAVNG
AIVGHSAIEIAEKAGLKVPAGTKMLLAEIPDATMEHPLALEKLSPVLALIKSDGVEDGFK
KAEGMLNLGGLGHTAVIHTENEELQLQYGIRMKACRVLVNSPSAEGGIGNIYNNMIPSLT
LGCGSHGHNSVSHNVSSFDLLNVKTLSKRRNNMQWFRVPPKIFFEKDSITYLRHIDAERV
MLVCDPGMVQFGYADLVKRQLELNRHRPAVDVFSDVEPNPSTNTVYKGLERFVDFQPDVI
IALGGGSAMDAAKAMWMFFEHPDVSFFGAKQKFLDIRKRTYKIPYAQKTTFICIPTTSGT
GSEVTSFAVITDSETHIKYPLADYALTPDIAIVDPALVMSVPASVTADTGMDVLTHAIES
YVSVMASDYTRGLSLQAIKLVFENLEHSYRFGDEESREKMHNASTMAGMAFANAFLGINH
SLAHKVGPMFDIPHGRTNAILMPHVIRYNGRDPQKHAMFPKYDYFRADKDYADIARFMGW
GTDKQSDAELVEVLAQKVYELGVAVGIDMNWKGQGVTKKLLQDTAYTLAEHAYEDQCTTA
NPKEPLISELKEIIEIAFDYKG
NT seq 2589 nt   +upstreamnt  +downstreamnt
atgactaaacaaactaaagatgttcaaacagtaattgatgaattggcaacaaagggtgtt
gaagcccttgatgctatggctaactttacgcaggagcaagtggaccatattgttcaccaa
gctgcgattgctgccctagataaacacatgtatttggctaaattggccgttgatgaaaca
gggcgtggtatttatgaagataaagccatcaagaacatgtatgcttctgaatacatttgg
aatagtattaaatatgacaaaactgtaggcgttattgctgaagataaagaacaaggtttg
gtttctatcgctgaaccggtcggtgttatctgtggggttacaccaacaactaacccaact
tcaacaacgattttcaaagccctcattgcattgaagacacgtaactctattgtcttcgcc
ttccacccatcagctcaaaaatcatctgcagaagctgctcgtattgttcgtgatgcggct
attgaagcaggtgctcctaaggattgtatccagtggattgaagagccatctatcgaagca
actggtcttttgatgaaccatcctaagattgctacggtacttgcgactggtggacctggt
atggttaaggccgcttattcaactggtaaaccagctcttggtgtaggagccgggaacgta
ccatcttatattgctgctgatgctaaagttaaacgtgctgtcaacgatatcatcgtttca
aaaacttttgacaatggtatgatttgtgcttctgaacaagcagctatcgttgatgcagct
atttatgatgaagttaaggctgaattcgaagcacatcaatgtgtcatcatttctaaaaaa
gctgatattgctaaattggaaaaagtcgttcttaatgaagcacgcacagctgtaaacggc
gctattgtaggtcactcagctattgaaattgctgaaaaagctggtcttaaagtacctgca
ggtacaaaaatgcttttggcagaaattccagatgcaacaatggaacatccacttgccttg
gaaaaattgtctccagtacttgcccttatcaaatctgatggcgttgaagatggattcaaa
aaagcagaaggcatgctcaatttgggaggtcttggacatacagctgttatccacactgaa
aatgaagagctccaactccaatacggtattcgcatgaaagcttgccgtgtcttggtgaat
agcccatcggctgaaggtggtattggtaatatctacaacaacatgattccatcattgact
cttggttgtggttcacacggtcataactcagtgtcacacaatgttagctcattcgacctc
ttgaatgtcaaaacattgtcaaagcgtcgcaataacatgcaatggtttcgcgtcccacca
aaaatcttcttcgaaaaagattcaataacttacttgcgtcacattgatgcagagcgcgtg
atgttggtttgtgaccctggtatggttcagtttggttacgctgacttggttaaacgccaa
ttggaacttaaccgccacaggccagcagtagatgttttctcagatgttgagccaaaccca
tctactaatacggtttacaaaggtttggaacgctttgtagacttccaaccagatgttatc
atcgctcttggtggtggttctgcaatggatgctgctaaggctatgtggatgttctttgaa
cacccagatgtaagcttcttcggtgctaaacaaaaattcttggatattcgtaaacgtact
tacaagattccttacgctcagaagacaacatttatctgtatcccaacaacttcaggtaca
ggttcagaggtaacgtcattcgcggttatcactgatagtgaaactcatatcaagtaccca
ttggcagattatgctttgactccggacattgctatcgttgaccctgctttggttatgagt
gtacctgccagcgttacagctgatacaggtatggacgttttgactcacgccattgaatct
tatgtatcagtcatggctagcgactatacacgtggactttcacttcaagcgattaaactt
gtttttgaaaatctcgaacattcttaccgctttggtgatgaagaatcacgtgaaaaaatg
cataatgcgtcaacaatggctggtatggcctttgccaatgccttccttggtatcaaccac
tcactcgctcacaaggttggccctatgtttgacattccacacggacgtactaatgcgatt
ttgatgcctcacgttatccgttacaatggtcgtgatcctcaaaaacacgctatgttccct
aaatatgactacttccgtgcagacaaagattacgcagatatcgctcgtttcatgggatgg
ggtactgacaaacaatcagatgctgaattggttgaagttttggcacaaaaagtatacgaa
ttgggtgttgccgttggtattgacatgaactggaagggtcaaggtgtcactaagaaactt
cttcaagacactgcctatactttggctgaacatgcttatgaagaccaatgtacaacagct
aatccgaaagaaccacttatttcagaattgaaagaaattatcgaaattgcctttgattac
aaagggtaa

DBGET integrated database retrieval system