KEGG   Streptococcus parauberis: STP_0090Help
Entry
STP_0090          CDS       T01504                                 

Definition
(GenBank) 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase
  KO
K01815  4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase [EC:5.3.1.17]
Organism
stk  Streptococcus parauberis
Pathway
stk00040  Pentose and glucuronate interconversions
stk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STP_0090
Enzymes [BR:stk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.17  5-dehydro-4-deoxy-D-glucuronate isomerase
     STP_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KduI
Motif
Other DBs
NCBI-ProteinID: AEF24538
LinkDB All DBs
Position
98584..99429
Genome map
AA seq 281 aa AA seqDB search
MRQQTFETRYTHAPNDIEHFSTEELRNEFVIESIFEPGWIHLTYTHNDRLIFGGVEPLDE
PLEIVLDKVLGVDYFLQRRELGFINIGGDGSVIIDGIEDEVLHRDSYYVGKETKEVIFKS
KDPKNPAKFYVASAPAHQKYPSKKIALANIIPLTPGDDEHMNKRKINQYVHPNQVESCQL
QMGLTSLAKGSSWNTMPCHTHERRAEVYMYFELPEEDAVFHMMGKPNATKHVVLHNEQGA
ISPSWSIHAGVATSNYSFIWLMAGENITYDDMDIVPINELK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacaaacttttgaaacacgatatacacatgcaccaaatgatattgaacatttt
agtactgaggaattgcgaaatgaatttgtcattgaaagtattttcgaaccagggtggatt
catctaacatatactcataacgatcgtcttatttttggtggtgtagaacctttagatgag
ccgttggaaatcgttttggataaagttttaggagttgactactttttacaacgtcgagaa
ttaggttttattaatattggcggagatggaagcgttatcatagacggtattgaagatgaa
gtcttgcatcgtgatagttattatgttggaaaagagactaaagaagttatttttaaatct
aaggacccaaaaaatccagctaaattttatgtggcttctgccccagcgcatcaaaaatac
ccaagtaaaaaaattgccttggcaaatattattccacttactcctggggatgatgagcat
atgaataagcgcaaaattaatcaatatgtacatccaaatcaagttgaatcttgtcagcta
caaatgggattaacatctttagccaaaggttcttcttggaacacaatgccatgtcataca
catgaacgacgcgcggaagtttatatgtattttgaattaccagaagaagatgcagtcttc
catatgatgggtaaacctaatgctacaaagcatgttgttttgcataatgaacaaggtgca
atcagtcctagttggtctatccatgcgggtgtagcaacaagtaactattcatttatctgg
ttgatggcaggtgaaaatattacttatgatgatatggatattgtgcctatcaatgaattg
aagtag

DBGET integrated database retrieval system