KEGG   Streptococcus parauberis: STP_0174Help
Entry
STP_0174          CDS       T01504                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
stk  Streptococcus parauberis
Pathway
stk00220  Arginine biosynthesis
stk00250  Alanine, aspartate and glutamate metabolism
stk00290  Valine, leucine and isoleucine biosynthesis
stk01100  Metabolic pathways
stk01110  Biosynthesis of secondary metabolites
stk01130  Biosynthesis of antibiotics
stk01210  2-Oxocarboxylic acid metabolism
stk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STP_0174
   00290 Valine, leucine and isoleucine biosynthesis
    STP_0174
   00220 Arginine biosynthesis
    STP_0174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stk01007]
    STP_0174
Enzymes [BR:stk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     STP_0174
    2.6.1.66  valine---pyruvate transaminase
     STP_0174
Amino acid related enzymes [BR:stk01007]
 Aminotransferase (transaminase)
  Class I
   STP_0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha Alliinase_C
Motif
Other DBs
NCBI-ProteinID: AEF24622
LinkDB All DBs
Position
197841..199055
Genome map
AA seq 404 aa AA seqDB search
MKIFEKSSKLDHVAYDIRGPVLEEAERMMANGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARASEGYSDSRGIFSARKAIMQYCQLKKFPDVDIDDIYLGNGVSELISMSMQALLNDGD
EVLVPMPDYPLWTACVSLSGGKAVHYLCDEESNWYPDIEDIKSKVSNKTKAIVVINPNNP
TGALYPDEILEDIIQIARENELIIFADEIYDRLVMDGGEHTAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKKNVRGYIEGLNMLANMRLCSNVLAQQVVQTSLGGYQSVDELL
LPGGRIYEQRNFIHKAINDIPGLSAVKPKAGLYIFPKIDRNMYNIDDDELFVLDLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPRVEELADVQEKITRVLSKYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttgaaaaatcatcgaaattagatcatgtggcttatgatatccgtggtcca
gttttagaagaagcagaacgcatgatggcaaatggcgaaaaaatattgcgattaaatact
ggaaatccagctgcttttggatttgaagccccagatgaagttattcgtgatttgattgtc
aatgcgcgtgcaagtgaaggctactctgacagtagaggaatattttcagcccgtaaagca
attatgcaatattgtcagcttaaaaaatttccagatgttgatattgatgatatatattta
ggaaatggtgtatcagaattaatttcaatgtctatgcaagctttacttaatgacggggat
gaagtgctagtaccgatgcctgattatccactatggacggcctgtgtcagtctatcaggt
ggtaaagctgttcattatttatgtgatgaagagtcaaattggtaccctgatattgaagac
attaaatcaaaagtatccaataagactaaagcaatcgtcgttattaatcctaataaccca
acaggtgctctataccctgatgagatattagaagatattattcaaattgcacgagaaaat
gaattgattatcttcgctgacgagatttatgatcggttagtgatggatggtggtgaacat
actgctattgctagtctggcaccagatgtattctgtgtctcaatgaatggcttatctaag
tcacatcggattgcaggttttcgtgttggttggatggttttatctggtcccaaaaaaaat
gtccgtggctatattgaaggactaaatatgttagctaatatgcgtttatgttcaaatgta
ttggctcaacaagttgttcaaacctcactaggaggttatcaatctgtagatgaattgtta
ttacctggtggacggatttatgagcaacgtaattttattcataaagcaattaatgatatt
ccaggtttatctgctgttaagccaaaagctggactttacattttccctaaaattgatcgc
aatatgtataatattgatgatgacgaactctttgtattagatttattaaaacaagagaag
gtgatgcttgtccatggtcgtggtttcaactggaaagaccctgatcatttccgaatagtc
taccttccaagggtggaagagctagcagatgtgcaggaaaaaataacacgtgtgctaagc
aaatacaaacgttaa

DBGET integrated database retrieval system