KEGG   Streptococcus parauberis: STP_0342Help
Entry
STP_0342          CDS       T01504                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
stk  Streptococcus parauberis
Pathway
stk00500  Starch and sucrose metabolism
stk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STP_0342
Enzymes [BR:stk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     STP_0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70 Imm53
Motif
Other DBs
NCBI-ProteinID: AEF24790
LinkDB All DBs
Position
361252..362718
Genome map
AA seq 488 aa AA seqDB search
MTNDLIMQAFEWYLPADSKHWQKLQASIPELQKLGISKIWLPPAFKGTGTNDVGYGIYDL
FDLGEFDQNGTVPTKYGSKEEYLSLVSELNKAGIQPIADVVLNHKANADQKETFYVLKMN
PENRQEPISEPYEIEGWTGFNFPGRKNKYNNFKWHWYHFSGLDYDARNNETGIYLIAGDN
KGWADQETVDNEKGNFDYLMFNDIDFKHPEVRQHLKDWTKWYISESQVKGFRLDAIKHID
ASFMKEFITFIQAEIDENFYIFGEYWKDDFDATEHYLELIDYKFDLFDVALHMNFYQACQ
AGNNFDMRQIFDGSLVQTHPMHAITFVENHDTQKGQSLQSNIEDWFKPIAYSLVMLRQDG
LPCVFYGDYYGIEGDDFGQPSFKNDLDKLAFLRKEFAYGQEVDYFDHANCIGWTRLGDDE
HQSALAVVVSNGDKGWKHMEVGQLYAGQTFVDYMGNSSEEMTIDENGWADFHAQAGSVSA
WVPKNKIK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgatttaattatgcaagcttttgaatggtatttaccagcagatagtaagcat
tggcaaaaactacaagcttcaattcctgaattacaaaaattaggaatcagcaagatatgg
ttaccaccagctttcaaaggaactggtacaaatgatgttggatatggtatatatgacctt
tttgacttaggtgagtttgatcaaaatgggacagttccaactaaatatggtagcaaagaa
gagtatctttctttagtctcagaattaaataaagccggaattcagccaattgctgatgta
gtcttaaatcataaggcaaatgccgatcaaaaagagacattttacgttttgaagatgaat
cctgaaaatcgtcaagaaccaatttctgaaccatatgaaatagaaggctggacaggattt
aatttcccaggtcgtaaaaataagtataacaacttcaaatggcattggtatcatttttct
ggtttagattatgatgcaagaaataatgaaacaggtatttacctaatagctggtgacaat
aaaggttgggcagatcaagaaactgttgacaatgaaaaagggaattttgattacctcatg
tttaatgatattgattttaaacaccctgaggttagacaacaccttaaagactggacaaaa
tggtacatcagtgaatcgcaagttaaaggtttcagattggatgctattaaacacattgat
gcttccttcatgaaagaattcattacctttattcaagcagagattgatgagaatttttat
atctttggtgaatattggaaagatgattttgatgcgacagaacattatcttgaattaatt
gactataaatttgatctctttgatgttgccttgcatatgaatttttaccaagcatgtcaa
gcaggaaataatttcgatatgcgtcagatttttgatggttctttggttcaaactcatccc
atgcatgcaatcacttttgtagaaaatcatgatacacaaaaagggcaatcattacaaagt
aatattgaagactggtttaaaccgattgcttattccttagttatgcttcgtcaagatggt
ttgccatgtgtcttttatggagattactatggtattgaaggtgatgactttggtcaacct
tcctttaaaaatgaccttgataaattagccttcttaaggaaagaatttgcttatggacaa
gaagttgactatttcgaccacgctaattgtattggttggacaagactcggtgatgacgag
catcagtctgctttagcagtagtcgtaagtaatggcgataaaggttggaaacatatggaa
gttggtcaactctatgccggccaaacttttgttgattatatgggtaatagttccgaagaa
atgaccattgatgaaaatggatgggcagattttcatgcccaagcaggctctgtttcagca
tgggtacctaagaacaaaataaaataa

DBGET integrated database retrieval system