KEGG   Streptococcus parauberis: STP_1768Help
Entry
STP_1768          CDS       T01504                                 

Gene name
ndh
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
stk  Streptococcus parauberis
Brite
KEGG Orthology (KO) [BR:stk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STP_1768 (ndh)
Enzymes [BR:stk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     STP_1768 (ndh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA FAD_oxidored Thi4 HI0933_like AlaDh_PNT_C DAO FAD_binding_3 Glutaredoxin NAD_binding_9 LPD7 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEF26216
LinkDB All DBs
Position
2029606..2031141
Genome map
AA seq 511 aa AA seqDB search
MSLTPDIKNQIKQYLDLLESDIVFQVNLGDDQNSKNVKEFLEEIANMSSKITIEEKSLTR
QPSFKIAQLDKESGVEFAGIPLGHEFTSFVLALLQVSGRPPKIEQELANQIKAIDKELHF
ETYVSLSCHNCPDVVQAFNIMSVLNPKISHTMIEGGMFQDEVKERGIMAVPTVYLDNQVF
SSGRTTVEQLLEKITGPASADNFSEKGVYDVLVIGGGPAGNSSAIYAARKGLKTGLLAET
FGGQVMETVGIENMIGTLYTEGPKLMAQIEEHTKSYNVDIIKVQLATSIAKKEDLIEVTL
ANGAVLQAKTAILALGAKWRNINVPGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSG
MEAALDLAGLCKQVTVLEFLPEVKADQVLQDRAAKTNNLTIITNAATKDIVGQDHVTGLN
YTDRESQEEKHIDLEGVFVQIGLVPNTQWLKDSGIELTDRGEIVVDGHGSTNIPGIFAAG
DCTNSIYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttactccagatattaagaaccaaatcaaacaataccttgatctattagaatct
gatattgtctttcaagtaaaccttggtgatgatcaaaattctaaaaacgtaaaagagttt
ttagaagaaatagcaaacatgtctagtaaaattacaatcgaggaaaaatcactaactcga
caacccagttttaaaattgcccaattagataaagaaagtggtgttgaatttgctggtatt
ccactcggacatgaattcacatcatttgttttagctttgttacaagtttctggtcgacca
ccaaagattgaacaagagctggcgaatcaaattaaagcaattgataaagagcttcatttt
gaaacttatgttagtttatcatgtcataattgtcctgatgtagtacaggcatttaatatc
atgtcagtcttaaatcctaagatttcacacaccatgattgaaggtggcatgttccaagac
gaggttaaagaaagaggaatcatggccgtcccaacggtctacctagataaccaagtcttt
tcttcaggacgtaccactgttgaacagctattggaaaagattaccggcccagcctctgct
gacaatttttcagaaaaaggcgtatatgatgtccttgtcattggcggtggccctgcgggc
aatagctctgcaatctacgctgcgcgtaaaggactgaaaactggccttctagctgaaact
ttcggtggacaagtaatggagactgtcggcattgaaaatatgattggtactctttatact
gaaggtcctaaattaatggcccaaattgaagagcatacaaaatcttataatgttgatatt
atcaaagttcagttagctacttcgattgctaaaaaagaagatttaattgaagtaacactt
gctaatggtgctgtattacaagctaaaacagcaatcctagcccttggggcaaaatggcgt
aacatcaatgttccaggtgaagatgagttccgtaacaaaggggtgacctactgtccacat
tgtgacggaccactatttgaaggaaaagatgttgctgttataggtggcggtaattcaggt
atggaagctgccttagacttagctggtttatgtaaacaagtaactgtcttagagttttta
cctgaagtaaaagctgatcaagtccttcaagatcgcgctgcaaaaacaaataatttaacc
attattactaatgcagcaacgaaagatattgtcggtcaagatcatgtaacaggtctcaac
tacactgaccgagaaagccaagaagaaaagcatattgacttagaaggtgtctttgtccaa
attggacttgtaccgaatacccaatggcttaaagatagtggaattgaattaactgaccga
ggcgagattgtcgttgacggccatggttctacaaatattcctggtatctttgctgctggt
gattgtacaaactctatttataaacaaattatcatttctatggggtcaggagcaactgct
gccattggcgcatttgactacttaatccgtcaataa

DBGET integrated database retrieval system