KEGG   Streptococcus thermophilus LMG 18311: stu0633Help
Entry
stu0633           CDS       T00213                                 

Gene name
grk
Definition
(GenBank) glycerate kinase, putative
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00260  Glycine, serine and threonine metabolism
stl00561  Glycerolipid metabolism
stl00630  Glyoxylate and dicarboxylate metabolism
stl01100  Metabolic pathways
stl01120  Microbial metabolism in diverse environments
stl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    stu0633 (grk)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    stu0633 (grk)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    stu0633 (grk)
Enzymes [BR:stl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     stu0633 (grk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_kinase
Motif
Other DBs
NCBI-ProteinID: AAV60339
UniProt: Q5M563
LinkDB All DBs
Position
598960..600075
Genome map
AA seq 371 aa AA seqDB search
MRILIAPDSFKESLSAKEVALALKSGLEKALPDADFDLMPIGDGGEGTLDALAENLNLEK
KTVKIPHAYTGDGSVPYASNGQTAIFEMAAVCGLEQVPKDKRNPLCITTQGVGELIVHLV
KSGISDFIIGVGGSATNDGGIGMAYGLGYRFYDSEGRELEPIGANLGHVKKVSSKNKLDL
SNVTIRLITDVDNPLCGLNGATYIFGSQKGLAPSQVKKVDQNMAQFYQGFAPEVPKLAGS
GAGGGMAAGMVAFEGAEIKSGIDFVLDCVDFDQRVKTADLVIVGEGRMDNQSLSGKAPVG
VAKRTPSAISVIAICGSLKDDLPDFPVGGISAAFPIIGQLGDLDQILSSAKENLYRTGLN
IGNLIKLSQSL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattctgattgcacctgattcgtttaaggaaagtttgtctgcaaaagaggttgcc
ctagctcttaaatcgggccttgaaaaggccttaccagacgctgattttgacctcatgcca
ataggcgatggtggcgaaggtaccttagatgctcttgctgaaaatctaaatcttgagaag
aaaactgttaagattccacatgcttatacaggtgatggatctgtcccctatgctagtaat
gggcagactgccatttttgaaatggctgcggtttgtggcttggagcaggtacctaaggat
aaacgcaaccccctttgtataacaacccagggagtcggtgaactgattgttcacttggtt
aaatctggtattagtgattttattataggtgtaggtggatcagctactaatgatggcgga
attggtatggcttatggattaggttatcgtttttatgattctgaggggcgggagcttgag
ccaataggtgccaatcttggtcacgttaaaaaggtgtcttctaaaaataaacttgatcta
tctaatgtaactattcgtcttatcaccgatgtggataatcctttgtgtggtttaaatggg
gcaacctatatttttggtagtcaaaagggcttggctccttcacaagttaaaaaggttgac
caaaacatggctcaattctaccaaggatttgctcctgaggttccaaaactagctggttca
ggtgctggagggggaatggcagcaggcatggtagcctttgaaggagcagaaattaagtcg
gggattgattttgtactggattgtgtcgattttgatcagcgtgtaaaaacagctgatttg
gttattgttggggaaggacgtatggataatcagtccttatctggtaaagcaccagtaggt
gtagccaaacgaacaccatcggctatctcagttatcgctatttgtggcagtttgaaggat
gacttacctgattttccagtaggtggcatttcagccgcttttccaatcattggtcaatta
ggtgacttagatcaaattctgtcttcggctaaggaaaatctctatcgaacaggactcaat
attggaaacctcatcaagttgagtcagtcattgtga

DBGET integrated database retrieval system