KEGG   Streptococcus thermophilus LMG 18311: stu0755Help
Entry
stu0755           CDS       T00213                                 

Gene name
glyA
Definition
(GenBank) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00260  Glycine, serine and threonine metabolism
stl00460  Cyanoamino acid metabolism
stl00630  Glyoxylate and dicarboxylate metabolism
stl00670  One carbon pool by folate
stl00680  Methane metabolism
stl01100  Metabolic pathways
stl01110  Biosynthesis of secondary metabolites
stl01120  Microbial metabolism in diverse environments
stl01130  Biosynthesis of antibiotics
stl01200  Carbon metabolism
stl01230  Biosynthesis of amino acids
Module
stl_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:stl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    stu0755 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    stu0755 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    stu0755 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    stu0755 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    stu0755 (glyA)
Enzymes [BR:stl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     stu0755 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AAV60446
UniProt: Q5M4W1
LinkDB All DBs
Structure
PDB: 

Position
712864..714114
Genome map
AA seq 416 aa AA seqDB search
MIFDKEDYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYP
GKRYYGGTAVIDVVETLAIERAKKLFGVKFANVQPHSGSQANAAVYMSLIQPGDTVMGMD
LSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSR
IIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLI
LTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADV
FNQHPDFRVISGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTS
GIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLY
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgataaagaagattacaaagcatttgaccctgaactatggaacgccatcgat
gctgaggcagaacgccaacaaaataatattgaattgattgcctctgaaaacgtggtttct
aaagccgttatggctgctcaaggaacgctcttgactaacaaatacgcagaaggctatcca
ggtaaacgttactatggtggtacagccgttattgatgtggttgagactcttgccattgaa
cgtgctaagaaactttttggggtaaaatttgctaacgtgcaacctcactcaggtagccaa
gccaatgctgctgtttacatgtctttaatccaacctggtgatacagttatggggatggat
ttgtcagcgggtggtcacttgacacatggtgcaccagttagtttctctggtaagacctat
aactttgtgtcttacaatgttgataaggaaagtgaacttcttgattatgatgctatcctt
gctcaagcaaaagaagtgagacccaaacttatcgtggcaggggcttcagcatactcacgt
atcattgattttgctaaattccgtgaaatcgctgatgctgtaggtgcttacctcatggta
gatatggctcacattgcaggtcttgtagcctctggtcatcatccaagtccggttccttat
gcacatgtgacaactacaacaacccacaagacacttcgtggacctcgtggtggtttgatt
ttgactgatgatgaagatatcgctaagaaattgaattctgcggtcttccctggtttgcaa
ggtggcccactggaacacgttattgctgccaaggctgtcgctcttaaagaagcacttgac
cctgcctttaaggaatacggtgaaaatgttatcaagaatgctgctgccatggcggacgtt
ttcaaccaacatccagatttccgagtaatctcaggtggaactaataatcatctcttcttg
gttgatgttactaaagttgtcgaaaatggtaaggttgcgcaaaacgttcttgaagaagta
aatattactttgaacaaaaatagtattccttatgagcagttatctccattcaaaacatct
ggtattcgtgtcggtagtccagcaattacaagccgtggtatgggtgaagctgagagccgt
cagattgcagagtggatggttgaagctttggaaaatcacgataaacctgaagttttggaa
cgcattcgtggagacgttaaagttcttacagatgctttcccactctattaa

DBGET integrated database retrieval system