KEGG   Streptococcus thermophilus LMG 18311: stu1004Help
Entry
stu1004           CDS       T00213                                 

Gene name
pstB1
Definition
(GenBank) phosphate ABC uptake transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    stu1004 (pstB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stl02000]
    stu1004 (pstB1)
Enzymes [BR:stl01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     stu1004 (pstB1)
Transporters [BR:stl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    stu1004 (pstB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_15 AAA_21 SMC_N RsgA_GTPase AAA_22 AAA_29 AAA_28 Rad17 AAA_23 AAA AAA_16 AAA_18 NB-ARC AAA_33 MMR_HSR1 Adeno_IVa2 AAA_30 G-alpha ATPase_2 AAA_14 AAA_24 RNA_helicase PRK AAA_25 NACHT AAA_5
Motif
Other DBs
NCBI-ProteinID: AAV60664
UniProt: Q5M4F3
LinkDB All DBs
Position
901290..902093
Genome map
AA seq 267 aa AA seqDB search
MTKYNWDERHIITFPEKKLALETKDLHVYYGQKEAINGIDMQFEKNKITALIGPSGCGKS
TFLRSLNRMNDTIDVAKVTGQILYEGVDVNASNINVYEMRKHIGMVFQRPNPFAKSIYKN
ITFAHECNGVKDKQTLDEIVETSLKQAGLWEQVKDDLHKSAFTLSGGQQQRLCIARAIAV
KPQILLMDEPAASLDPVATMQLEETMFELKEDYSIIIVTHNMQQAARASDYTAFFYLGDL
IEYDETKKIFQDAALQSTSDYVSGRFG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatacaattgggacgagcgtcatattatcaccttcccagagaagaagctcgct
cttgaaaccaaggatttgcatgtctactatggtcaaaaagaagccatcaatggtattgat
atgcaattcgaaaaaaataaaatcactgcactcatcggtccctcaggatgtgggaaatca
acctttcttcgtagcctaaaccgcatgaatgatactattgatgttgccaaggttactggg
caaatcctttatgaaggagttgatgtcaatgcaagtaatatcaatgtttatgaaatgcgc
aaacacattggaatggtctttcaacgtccaaacccatttgccaagtctatctataaaaac
atcacctttgcccatgaatgtaatggtgtgaaagataagcaaactttggatgagattgtt
gaaacatcacttaaacaagcgggactttgggaacaagtaaaagatgaccttcataagtca
gcttttacactctctggtggtcaacaacaacgtctttgtatcgcaagggctatcgccgtt
aaaccacagattcttcttatggatgagccagcagcttcattagatcctgtagctactatg
cagctagaagaaaccatgtttgagctgaaagaagattattccattattatcgtcacacac
aatatgcaacaagcggctcgtgccagtgattatacagcatttttctaccttggtgatctt
atcgaatatgatgaaaccaagaaaatcttccaagatgctgctctacagtcaaccagtgac
tatgtatcaggacgctttggatag

DBGET integrated database retrieval system