KEGG   Streptococcus thermophilus LMG 18311: stu1005Help
Entry
stu1005           CDS       T00213                                 

Gene name
pstB2
Definition
(GenBank) phosphate ABC uptake transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    stu1005 (pstB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stl02000]
    stu1005 (pstB2)
Enzymes [BR:stl01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     stu1005 (pstB2)
Transporters [BR:stl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    stu1005 (pstB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA_22 RsgA_GTPase AAA_15 NB-ARC AAA_16 AAA_30 ATPase_2 AAA_33 ABC_ATPase AAA_18 AAA_5 NACHT AAA_25 Cytidylate_kin AAA_28
Motif
Other DBs
NCBI-ProteinID: AAV60665
UniProt: Q5M4F2
LinkDB All DBs
Position
902106..902864
Genome map
AA seq 252 aa AA seqDB search
MTEPIISINDLSVYFNKKKAINNVTMDFYPNEITALIGPSGSGKSTLLRSINRMGDLNPE
CTVTGAVSYNGHNVYSPRTDTVELRKEIGMVFQQPNPFPMSIYENVVYGLRINGIKDKAV
LDKAVEESLKGASVWEEVKDRLHDSALGLSGGQQQRVCVARVLATSPKVILLDEPTSALD
PISAGKIEETLYNLKDQYTLLLVTRSMQQASRISQRTAFFLDGELIEYSSTKDMFLNPQH
KETEDYITGKLG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaccaatcatttcaatcaatgatttatcggtgtatttcaataagaaaaaagcc
attaataatgtgactatggatttctatccaaatgaaatcacagcccttatcgggccatct
ggatcaggaaaatcaaccttgcttcgttctatcaacagaatgggggacttaaaccctgaa
tgcacagttactggtgcagtttcctacaatggccataatgtctacagtcctcgaacagat
actgttgaactccgtaaggaaattggtatggtcttccaacaacccaatcccttccctatg
tctatatatgagaacgtagtctatggccttcgtatcaatggtatcaaagataaggcggtt
cttgacaaagcagtagaagaatctctaaaaggagcttcagtctgggaggaggttaaggac
cgacttcatgactcagcacttggtctttcaggtgggcaacaacaacgagtttgtgttgca
cgggtacttgccacctcaccaaaggtgattcttcttgacgaaccaacatctgccctagac
cctatttccgctggtaagattgaagaaacactctataaccttaaagatcaatatacattg
ttgcttgtcacacgttctatgcaacaggcaagccgtatatctcaacgaacagcctttttc
ctcgatggagaacttattgagtattcatcaactaaagacatgttccttaatccacaacac
aaagaaaccgaagattacattaccggtaagttaggttaa

DBGET integrated database retrieval system