KEGG   Streptococcus thermophilus LMG 18311: stu1049Help
Entry
stu1049           CDS       T00213                                 

Gene name
acoC
Definition
(GenBank) acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00010  Glycolysis / Gluconeogenesis
stl00020  Citrate cycle (TCA cycle)
stl00620  Pyruvate metabolism
stl01100  Metabolic pathways
stl01110  Biosynthesis of secondary metabolites
stl01120  Microbial metabolism in diverse environments
stl01130  Biosynthesis of antibiotics
stl01200  Carbon metabolism
Module
stl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu1049 (acoC)
   00020 Citrate cycle (TCA cycle)
    stu1049 (acoC)
   00620 Pyruvate metabolism
    stu1049 (acoC)
Enzymes [BR:stl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     stu1049 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 IF3_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: AAV60701
UniProt: Q5M4C6
LinkDB All DBs
Position
complement(938873..940261)
Genome map
AA seq 462 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGEIVPVTEVIGYIGAEGEVVADNAAIAPAAEAAPQVEKVADVETPAAKPQPQVAIVH
EGGKIRATPKARKVAREMGIDLAQVLGTGAKGRIHADDVENFKGAQPKATPLARKIAADL
GIDLATVSGTGFGGKITKEDILAISAPAQVKVAAAAPAVEAKPEKVLPEGVEVIPMSAMR
KAISKGMTHSYLTAPTFTLNYDVDMTNLIALRKQVLDPIMNKTGMKVTFTDLIGLAVVRT
LMKEEHRYLNASLINDAQNIELHKFVNLGIAVGLDDGLVVPVIHGADKMSLSDFVVASKD
VIKKAQAGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGE
VVVRPIMGLCLTIDHRIVDGMNGAKFMVDLKHLLENPMELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagattattatgcctaagctcggtgtagacatgcaggaaggtgaaatcatc
gagtggaaaaaacaagagggagacgtggttaacgagggagatatccttcttgaaatcatg
tcagataagacaaacatggaacttgaagcagaagactcaggtgttcttttgaagattacc
cgtcaagctggtgaaatagtaccagttactgaggtgattggttatatcggagctgaagga
gaagttgtggctgataatgctgcaatcgcaccagctgcagaagctgcgccacaagttgaa
aaagttgctgatgtggaaacgcctgctgctaagcctcagccacaagtagctattgttcat
gaaggtggcaaaatacgcgcgacacctaaagcacgtaaagtggcacgtgagatggggatt
gacctcgctcaagttctcggaactggggcaaaagggcgtattcatgcagatgatgttgag
aactttaagggcgctcaacctaaggcaacaccattggctcgcaagattgcagcagacctc
ggtattgatttagctaccgtatctggaacaggatttggtggtaagattactaaggaagat
attcttgcaatcagtgctccagcacaagttaaggtggctgcagccgcacctgcggttgaa
gctaaacctgaaaaagtcttgccagaaggtgtggaagtcattccgatgtctgctatgcgt
aaggctatctctaagggaatgacgcactcatacttgactgcaccaacatttactcttaac
tatgatgtggacatgactaaccttatagctcttcgtaagcaagttcttgatccaatcatg
aataagactggtatgaaggtgaccttcactgatttgattggtttggcagttgtgcgtacc
cttatgaaagaggaacaccgttacctcaatgcatccttgattaatgatgcacaaaatatc
gaattacacaaatttgttaatcttggtattgcagttggtctagatgatggcttggttgta
ccagtcattcatggtgctgataagatgagtttgtctgactttgtggtggcctctaaggat
gtcatcaaaaaagctcaggctggtaaattgaaagcggcagaaatgtcaggttctactttc
tctattactaacttgggaatgtttggaaccaagtcattcaatccaatcattaatcaaccg
aactcagctatccttggtgtttcagcaactattcaaacaccggttgttgttgatggtgaa
gttgttgtgcggccaatcatgggtctttgcttgactattgaccaccgtattgttgatggt
atgaatggtgctaaattcatggttgatttaaagcatttgcttgaaaatccaatggaattg
ttgatttaa

DBGET integrated database retrieval system