KEGG   Streptococcus thermophilus LMG 18311: stu1121Help
Entry
stu1121           CDS       T00213                                 

Gene name
rpiA
Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00030  Pentose phosphate pathway
stl01100  Metabolic pathways
stl01110  Biosynthesis of secondary metabolites
stl01120  Microbial metabolism in diverse environments
stl01130  Biosynthesis of antibiotics
stl01200  Carbon metabolism
stl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    stu1121 (rpiA)
Enzymes [BR:stl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     stu1121 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC AAA_30 Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AAV60760
UniProt: Q5M481
LinkDB All DBs
Position
complement(988187..988867)
Genome map
AA seq 226 aa AA seqDB search
MDELKKLAGVYAAGFVEDGMVVGLGTGSTAYFFVEEIGRRIKEEGLSVVGVTTSTQTTKQ
AEGLGIPLKSVDDIDSIDVTVDGADEVDPQLNGIKGGGGALLMEKIVATPTKKYIWVVDE
SKMVDQLGAFKLPVEVVQYGADRLYLDFESKGYKPSFRVTEQGDRFVTDMKNFIIDLDLG
KINNPVALGDELKAMTGVVEHGLFNGMVNKVIVAGKDGVKIVEVKD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggatgaattaaaaaagctcgccggtgtatacgctgctggatttgttgaagatggcatg
gttgttggactaggtactggctcaacagcttatttctttgtagaggagattggtcgtcga
ataaaggaggaaggtctcagtgtagtaggtgtaacgacgtctactcaaacaacgaagcaa
gctgaaggtctaggtattcctttgaaatcagtggatgatattgatagtattgatgttacc
gttgatggcgccgacgaagtagatcctcaactcaacggtattaaaggtggcggtggtgcc
ctcttgatggaaaaaatcgttgccacacctacgaaaaagtacatctgggtagttgatgag
tctaagatggttgatcaacttggtgcttttaaattaccagtcgaagttgttcaatatggc
gctgatcgcttgtatctcgactttgaatctaagggctataagccatcattccgagtaact
gaacaaggtgatcgctttgttacagatatgaagaactttattattgatttggatctcggc
aaaattaataacccagttgctttaggtgacgaactaaaagctatgactggtgttgttgaa
catggcttattcaatggaatggttaataaggttatcgtcgctggaaaagatggtgttaag
attgttgaggttaaggattag

DBGET integrated database retrieval system