KEGG   Streptococcus thermophilus LMG 18311: stu1128Help
Entry
stu1128           CDS       T00213                                 

Gene name
xylH
Definition
(GenBank) 4-oxalocrotonate tautomerase
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00362  Benzoate degradation
stl00622  Xylene degradation
stl01100  Metabolic pathways
stl01120  Microbial metabolism in diverse environments
stl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    stu1128 (xylH)
   00622 Xylene degradation
    stu1128 (xylH)
   00621 Dioxin degradation
    stu1128 (xylH)
Enzymes [BR:stl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     stu1128 (xylH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase Tautomerase_2 DUF1904 Tautomerase_3
Motif
Other DBs
NCBI-ProteinID: AAV60767
UniProt: Q5M474
LinkDB All DBs
Position
994568..994753
Genome map
AA seq 61 aa AA seqDB search
MPFVKIDLFEGRSEEQKIELAREVTEVVSRVAKAPKEAIHVFINDMPEGTYYPHGEMKKK
N
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgtaaaaattgatctctttgaaggtcgttcagaagaacaaaaaattgaactt
gctcgcgaagttactgaagttgtatcacgtgttgcaaaagctcccaaggaagctatccat
gttttcattaacgatatgccagaagggacttactacccacatggtgaaatgaaaaagaaa
aactaa

DBGET integrated database retrieval system