KEGG   Streptococcus thermophilus LMG 18311: stu1399Help
Entry
stu1399           CDS       T00213                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00010  Glycolysis / Gluconeogenesis
stl00052  Galactose metabolism
stl01100  Metabolic pathways
stl01110  Biosynthesis of secondary metabolites
stl01120  Microbial metabolism in diverse environments
stl01130  Biosynthesis of antibiotics
Module
stl_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:stl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu1399 (galM)
   00052 Galactose metabolism
    stu1399 (galM)
Enzymes [BR:stl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     stu1399 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim MSP
Motif
Other DBs
NCBI-ProteinID: AAV61013
UniProt: Q8L2I1
LinkDB All DBs
Position
complement(1234569..1235615)
Genome map
AA seq 348 aa AA seqDB search
MKISCEIIGKVDSGDVSKISMENNNGVVISTLTTGATLQEFLVPTETGALKNIVLGFSDF
EDYYKNNLCACQSIGRVAGRIGKASYTHNMVLYSLPKNEGENCLHGGPKGMQVQNWNYVT
NLNDEYVETKFIRRLYSSVDGFPGDVTVSISYRLNNNNRLTILFEAFDVTESTIFNPTNH
VYFNLSDKQDLSSHELQIYSDYRLELDSELIPTGQKINVDETNYDFRKTTDLLPRIEANN
GFDDAFVVGGGTCDHVKEVAILHDKESGDGIEIFSNRNGLVIFTMDDIEDNIYFARDKGK
MAKRREAIAMEAQTLPDAVNHKGFGDIILDKGHSVNYEIGFQYFNSSR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagctgcgaaattattggaaaagttgattcaggcgatgtcagtaaaatttca
atggaaaataataatggtgttgtcatttccacactcacaacaggtgctacacttcaggag
tttttggttccaacggaaactggtgctcttaaaaatatagtacttggtttcagtgatttc
gaggattactataagaataatttatgtgcctgccagtccattggtagggttgctggaaga
attgggaaagcttcgtatactcataatatggttctttatagccttcctaagaatgaggga
gaaaactgcttacatggcggtccaaaaggaatgcaggtccaaaattggaactatgtcaca
aacctgaatgatgaatatgttgagacaaaatttattagaagactttattcaagtgtagat
ggctttcctggtgatgtgacagtctctattagttatagacttaacaataataaccgctta
acaatactctttgaagccttcgatgttacagagtcaacaatttttaatccgacaaaccat
gtttactttaatcttagcgacaaacaggatttatcaagtcatgagttacaaatctattca
gactatcgtttagagttggattctgagttaattccaacaggacaaaaaattaatgtagat
gaaacgaattatgattttagaaagacaactgacttgctacctcgaattgaagcaaataat
ggttttgatgatgcctttgtagttggagggggaacttgtgatcatgtgaaagaagtagct
attttgcatgacaaagaaagtggagatggtattgaaatcttctcaaacagaaatggttta
gtcatttttacgatggatgatatcgaagataatatttactttgcaagagataaaggcaaa
atggcaaaaaggcgtgaagctattgctatggaagctcaaacccttccagatgccgttaat
cacaaaggttttggagatattatcttagataaaggtcatagtgtaaactatgaaattggc
ttccaatactttaattcatcaagataa

DBGET integrated database retrieval system