KEGG   Streptococcus thermophilus LMG 18311: stu1583Help
Entry
stu1583           CDS       T00213                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00473  D-Alanine metabolism
stl00550  Peptidoglycan biosynthesis
stl01100  Metabolic pathways
stl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    stu1583 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    stu1583 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    stu1583 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stl01011]
    stu1583 (ddlA)
Enzymes [BR:stl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     stu1583 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:stl01011]
 Precursor biosynthesis
  Amino acid ligase
   stu1583 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK MsyB GARS_A
Motif
Other DBs
NCBI-ProteinID: AAV61186
UniProt: Q5M355
LinkDB All DBs
Position
complement(1400707..1401753)
Genome map
AA seq 348 aa AA seqDB search
MSKQTLILLYGGRSAEREVSVLSAESVMRAVDYNAFEVKTYFITQSGDFIKTQEFIETPG
DDEKLMTNDTVEASQAIKPSDIYEEDAVVFPVLHGPMGEDGSIQGFLETLKLPYVGTNVL
SSSVAMDKIMTKRILEVAGVPQVAYTVYIEGEDLEAAVAETLEKLTFPVFVKPANMGSSV
GISKAENESELRSAIDLALKYDSRILIEQGVVAREIEVGILGNTTVKTTDPGEVVKDVAF
YDYQAKYIDNKITMDIPARVPVEVMTQMRAYAAKAFRALGGCGLARCDFFLTEDGAIYLN
ELNTMPGFTQWSMYPLLWENMGLSYSDLIKELVVLGQEMFDKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaacccttatccttctctatggtggacgttcagcagaacgtgaagtgtct
gtactatcagctgagagtgttatgcgtgcggtagattacaacgcatttgaggttaaaacc
tactttatcactcagtctggtgattttatcaaaacacaagaatttatagaaaccccaggt
gatgatgagaagctcatgactaatgacactgttgaggctagtcaggctattaaaccaagc
gatatctacgaagaagatgctgtggtcttccctgtgcttcatggtcctatgggtgaggat
ggttctatccaaggtttccttgaaaccctcaagttgccatacgtggggaccaatgttctt
tcatcaagtgtagctatggacaagattatgaccaagcgtattcttgaagttgctggagtg
ccacaggttgcctacacagtctacatcgagggtgaagatttggaagcagcagtagcagag
acacttgaaaaattgaccttcccagtttttgtcaaaccagccaacatggggtcatctgtt
gggatttctaaagctgaaaatgaatcagagcttcgttcagcgattgatcttgctctcaaa
tatgatagccgtatcttgattgagcaaggtgtagttgctcgtgaaatcgaagttggtatc
cttggaaatacgactgtcaaaacgactgatccgggtgaagtggtcaaagacgtggctttc
tatgattaccaagccaagtacattgacaataagattaccatggatattccagctcgcgtg
cctgtcgaagtcatgacgcaaatgcgtgcctatgcggccaaggcctttcgtgctctaggg
ggttgcggtcttgcccgctgtgatttcttcctgacagaggatggagccatctaccttaat
gagctcaacaccatgccaggtttcactcaatggtcaatgtacccactactttgggaaaat
atgggactctcttactcagatcttatcaaggaattggtagttttgggacaagaaatgttc
gacaaacgtgaaagccatttgatttaa

DBGET integrated database retrieval system