KEGG   Streptococcus thermophilus LMG 18311: stu1636Help
Entry
stu1636           CDS       T00213                                 

Gene name
aspC2
Definition
(GenBank) aspartate aminotransferase, putative
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00220  Arginine biosynthesis
stl00250  Alanine, aspartate and glutamate metabolism
stl00290  Valine, leucine and isoleucine biosynthesis
stl01100  Metabolic pathways
stl01110  Biosynthesis of secondary metabolites
stl01130  Biosynthesis of antibiotics
stl01210  2-Oxocarboxylic acid metabolism
stl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    stu1636 (aspC2)
   00290 Valine, leucine and isoleucine biosynthesis
    stu1636 (aspC2)
   00220 Arginine biosynthesis
    stu1636 (aspC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stl01007]
    stu1636 (aspC2)
Enzymes [BR:stl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     stu1636 (aspC2)
    2.6.1.66  valine---pyruvate transaminase
     stu1636 (aspC2)
Amino acid related enzymes [BR:stl01007]
 Aminotransferase (transaminase)
  Class I
   stu1636 (aspC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AAV61239
UniProt: Q5M304
LinkDB All DBs
Position
complement(1448651..1449865)
Genome map
AA seq 404 aa AA seqDB search
MKTFDKSSKLEHVAYDIRGPVLDEANRMIAKGEKILRLNTGNPAEFGFTAPDEVIRDLIM
NVRNSEGYSDSKGIFSARKAIMQYCQLKGFPNVDIDDIYIGNGVSEMIPMSMQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYVCDEKSNWYPDIDDIKSKITSNTKAIVIINPNNP
TGALYPKDVLEQIVDIARQNDLIIFADEIYDRLVMDGKKHIAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKKNVRGYIEGLDMLSNMRLCSNVLSQHVIQTSLGGYQSVDELL
IPGGRIYEQREFITNTVNDIPGLTAVKPDAGLYIFPKIDRNMYDIDDDEEFCLRLLKKEK
VLLVPGKGFNWNEPDHFRIVYLPRVEELADLGNKIERVLLYYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttgataaatcatcaaagttggaacacgttgcctatgatattcgtggtcca
gttttggatgaggccaaccgtatgattgccaaaggtgaaaaaattctccgtctgaacaca
ggaaatcctgcggaatttggttttacagcaccagatgaagtcattcgtgacttaattatg
aatgttcgtaacagtgaggggtattcagatagtaaggggattttctcagctcgtaaggct
attatgcagtattgccagcttaagggtttcccaaatgtagacatcgatgatatctatatt
ggtaacggtgtgtcagagatgattcccatgtctatgcaggccttgcttgatgatggtgat
gaagtcttggttccaatgccagactatcctctttggacagcttgtgtcagtctagctggc
ggtaacgctgttcactatgtctgtgatgaaaaatctaactggtatccagacattgatgat
atcaaatcaaagattacatcaaatactaaggctattgttattatcaatccgaataacccg
acaggtgctctttaccctaaagatgttcttgaacagattgtcgatattgcacgccaaaat
gatttgattatctttgcggatgagatttatgaccgcttggttatggatggtaagaagcac
attgctattgcaagtcttgcaccagacgttttctgtgtatctatgaatggtctttctaaa
tctcaccgtatttgtggtttccgtgtaggttggatggttctttctgggcctaagaagaat
gttcggggctatattgaagggcttgatatgttgtccaatatgcgcctttgctctaatgtg
ctctctcaacacgtaattcagacctcacttgggggctaccaatctgttgatgagctcctg
attccaggtggtcgtatttatgaacaacgtgagtttattacaaacacagtaaacgatatt
ccaggactcacagctgttaagccagatgcgggtctttacatcttccctaagattgaccgc
aacatgtatgatattgacgatgatgaagagttctgtcttcgtcttttgaagaaggaaaag
gtcctcttggttccaggtaaaggctttaactggaatgaaccggaccacttccgtattgtc
taccttcctcgtgtggaagaattggctgatcttggaaataaaatcgagcgtgttttgtta
tattataagcgctaa

DBGET integrated database retrieval system