KEGG   Streptococcus thermophilus LMG 18311: stu1726Help
Entry
stu1726           CDS       T00213                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00473  D-Alanine metabolism
stl01100  Metabolic pathways
stl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    stu1726 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    stu1726 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stl01011]
    stu1726 (alr)
Enzymes [BR:stl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     stu1726 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:stl01011]
 Precursor biosynthesis
  Racemase
   stu1726 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAV61325
UniProt: Q5M2S7
LinkDB All DBs
Position
complement(1537602..1538705)
Genome map
AA seq 367 aa AA seqDB search
MISSLHRPTLAKVDLSAISENIEQVVSHIPKQVQTFAVVKANAYGHGAVEVAKHVSKQVD
GFCVSNLDEALELRQAGIEQPILILGVVLPDGVPLAIQENISLTVASLEWLTLAQKQGLD
LTGLTCHIKVDSGMGRIGVRNLKDADNLIAGLKALGADVEGIFTHFATADEADDSKFKRQ
LSFFTDLVDNLTDRPRLVHASNSATSIWHAATVFNTVRLGVVIYGLNPSGSVLELPYNIQ
PALSLETALIHVKTLPAGQDVGYGATYTTTDEEVIGTLPIGYADGWTRDLQGFHVIVDGQ
LCPIVGRVSMDQITVRLPKVYPLGTPVTLMGENGGVSITATEVAEKRGTINYEVLCLLSD
RVPRSYD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgagtttacatcgaccaaccttggcaaaggttgatctgtcagcaatttcagaa
aatattgaacaagtggttagtcatattcctaaacaggtgcagacttttgcagttgtaaag
gccaatgcttatggtcatggcgctgttgaagtggctaaacatgtgtctaagcaggtggat
ggtttttgtgtttctaacctagatgaggcgcttgaacttcgtcaagctggcatagagcaa
ccgatacttattttgggagtagtcttgccagatggtgttcccttggctattcaagaaaac
attagtctgacggtggcttcacttgagtggttgacactggctcagaaacaagggcttgat
ttgacaggtttgacctgtcatattaaggttgattcaggtatgggtcgtattggggtacgt
aacctaaaggacgcagataacttgattgctggtctgaaggctcttggtgctgatgtcgaa
ggtatttttactcattttgcaacagctgatgaagcagatgatagtaaatttaagcgtcaa
ttatctttcttcaccgatttggtggataacttgactgatagacctcgcttggtgcacgct
agcaactcagcgacaagtatttggcatgcagcaaccgtctttaatacggtacgtctgggt
gttgtcatctatggtctcaatcctagtggcagtgtcttggaacttccctataatattcaa
cctgccctaagtttagagacagctcttattcatgttaagacccttccagccggtcaagac
gtgggttacggtgcaacctatacaactacggatgaagaagttattggaacgcttccaatt
ggctatgcggatggttggactagagatttacaaggtttccatgttattgtggatggacaa
ctttgtcctattgttgggcgtgtgtctatggaccagatcactgttcgccttcctaaggtt
tatccactaggaactccagttacgcttatgggtgaaaatggaggagtgagcattactgcg
acagaggtggctgaaaagcgtggcacaatcaactacgaggtcctttgtttacttagtgat
cgtgtacctcgtagctatgactaa

DBGET integrated database retrieval system