KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0122Help
Entry
STM0122           CDS       T00065                                 

Gene name
ftsI
Definition
(RefSeq) peptidoglycan glycosyltransferase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00550  Peptidoglycan biosynthesis
stm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STM0122 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    STM0122 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stm01011]
    STM0122 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:stm03036]
    STM0122 (ftsI)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STM0122 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:stm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   STM0122 (ftsI)
Chromosome and associated proteins [BR:stm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    STM0122 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-GeneID: 1251640
NCBI-ProteinID: NP_459127
UniProt: Q7CR83
LinkDB All DBs
Position
141726..143492
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWLQIIAPDMLVRQGDMR
SLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALSTALNIP
LDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLAGTPKDAMRNRTIT
DVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERIFPESTVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcaaaaacgcaaaaatcgaaacgccaggaagaacagaccaacttcatc
agttggcgttttgcgttgctgtgcggctgtattttactggcgctggtttttttacttgga
cgcgcggcgtggctacagattatcgccccggatatgctggtgcgtcagggcgatatgcgt
tcgctgcgtgttcaggaagtctccacctcacgcggtatgattaccgaccgttccgggcgt
ccactggcggtcagcgtaccggttaaggcgatctgggccgacccgaaagaagttcatgac
gccggcggcatcagcgttggcgatcgctggaaagcgctttctactgcgctcaatattcca
ctcgatcagctctccgcccgtatcaacgccaacccgaaagggcgttttatttatctggcg
cgccaggtaaatcctgacatggcggactacatcaaaaaactcaaactgccggggattcat
ttgcgtgaagagtcccgccgctactacccgtcaggagaagtaaccgctcacctcatcggt
tttaccaacgtcgacagtcaggggattgaaggcgttgaaaagagctttgataagtggctt
accggtcagcctggcgagcgaatcgtgcgtaaagaccgctatggccgcgtgattgaggat
atctcctccactgacagtcaggcagcgcacaatctggcgttaagcattgatgaacgctta
caggcgctggtttaccgcgaactgaacaacgcggtggcgtttaacaaggcggaatccggt
agcgcggtgctggtcgatgtcaataccggtgaagtactggcgatggcgaatagcccttcc
tataaccccaacaaccttgccggtacgccgaaagacgcgatgcgtaaccgtaccatcacc
gacgtgtttgaaccgggttctacggttaagccgatggtggtgatgactgcgcttcagcgc
ggtatcgtcaacgaaaatacggtgttgaataccgttccataccgaattaacggccacgaa
attaaagacgtggcgcgctacagcgaattaaccctgaccggggttctacagaagtcgagt
aacgtcggtgtatccaaactggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttgggctaggaaaggcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtccgacatagagagggccaccttctctttcggctacggg
ctaatggtaacgccgttacagttagcgcgagtctatgcaaccatcggcagctatggcatt
tatcgcccgctgtcgattaccaaagttgatccgcctgtacccggcgaacgcatcttccct
gaatccaccgtacgcaccgtggtgcatatgatggaaagcgtggcgctgccgggcggcggc
ggcgtgaaggcagcgattaaaggctaccgtatcgcgattaaaaccggtacggcgaaaaaa
gtggggccggacggtcgctacatcaacaaatacattgcttacaccgcaggcgtcgcgcct
gcgagtcagccgcgcttcgcgctggtggttgtcatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtttccgcgccggtatttggtgccatcatgggcggcgttctgcgcacc
atgaacatcgaaccggacgcgctggcaacgggcgaaaaaaatgaattcgtaattaatcaa
ggcgagggaacaggtggcagatcgtaa

DBGET integrated database retrieval system