KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0924Help
Entry
STM0924           CDS       T00065                                 

Definition
(RefSeq) putative Fels-1 prophage Cu/Zn superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STM0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 1252443
NCBI-ProteinID: NP_459901
LinkDB All DBs
Position
complement(994965..995489)
Genome map
AA seq 174 aa AA seqDB search
MNKKLMTLAVFLFSSAASAASTDATVNLVNANGTGQKIGNITITETEYGLLFTPHLSSLP
AGIHGFHIHENGSCDAGMKDGKPVAALAAGGHLDPQHTNKHLGPYNPEGHLGDLPALYVN
QAGNADYPVLAPRLKSISQVKGHAIMIHTGGDNHEDHPNPLGGGGARIACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaagttaatgacacttgctgtatttttattcagtagtgcagcctcagcagca
agtaccgacgcaacggttaaccttgtaaatgccaatggcacaggtcaaaagatcggcaat
attacaattaccgaaacagaatatggcttgttattcaccccacatttgtcctcacttcca
gccggtattcatgggtttcatatccacgagaacggaagctgtgatgctggcatgaaggac
ggtaaacctgtcgcagcacttgctgccggagggcaccttgaccctcagcacacaaataaa
catctcggtccgtataatcctgaaggtcatctcggtgatcttccggcgctgtatgtaaat
caggcaggtaacgctgattatccggttctggccccacgcctcaaatcaatcagtcaggtc
aaaggccatgccatcatgatccataccggcggtgacaaccatgaagatcatcccaacccg
cttgggggcggtggtgcacgaatcgcctgtggcgttataaaataa

DBGET integrated database retrieval system