KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2584
Entry
STM2584           CDS       T00065                                 

Gene name
gogB
Definition
(RefSeq) type III secretion system protein
  KO
K23942  Gifsy-1 prophage leucine-rich repeat protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:stm00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    STM2584 (gogB)
SSDB
Motif
Pfam: FNIP LRR_4
Other DBs
NCBI-GeneID: 1254106
NCBI-ProteinID: NP_461519
LinkDB
Position
2728977..2730470
AA seq 497 aa
MTYRLKKRMKIGFQPAILQYAYTSNEATSNLELLNKWRIESPDIEKEERNSIYDKIIEAN
HTGSLSITAHHVTSIPVFPDNLSELNLSSCYTLESIPNLPDGLKSLTISGNQTIKISYFP
DSLESLSIDMQAYEENYTFPALPYGLKSFTACYGKFLPPLPPHLSSLSLQNFSEILCAEL
PYKLDKLDLQNCPFLPLMKMLPEELKELSIELIRTVPGTVIDDILPDKLKKLSINFCDNI
KLPVKLPVNLKSINLSSRTPIAWEIPTCNLPAHIDISTDGYVKLNPEFLTRSDITFSNKP
AGDVLSFQPGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFNKD
EKIAERLNDVQRGIFFREFLSQHKKYNITEDKYSDLSNEECWIKTSKAGLEFQTRLRERS
VIFVIDNLVDAISDIANKTGKHGNSITAHELRWVYRNRHDDLVKQNVKFFLNGEAISHED
VFSLVGWDKYKPKNRNR
NT seq 1494 nt   +upstreamnt  +downstreamnt
ttgacatatagattgaaaaagcgcatgaaaataggattccaaccagccatattgcaatat
gcatatacaagtaacgaggcgacatcaaaccttgagttattaaataaatggagaatagaa
tccccagatattgagaaggaggagcgtaatagtatttacgacaaaataatagaagcaaat
cataccgggagcttatcaattactgctcatcatgttacctctattccggtatttcctgat
aatttatccgaattgaatttatcttcatgctatacactggagtctattccaaatcttcct
gatgggttaaaaagtttaactatatctggaaatcagaccattaaaatttcatatttccca
gatagcttagagtcactatctatagatatgcaggcatatgaagaaaattatactttcccc
gcattaccttatggattaaagagttttactgcatgctatggtaaatttttgcctcccctt
cctccgcatctatcttctttgtcattgcaaaatttctctgaaatattatgtgctgagtta
ccatataaattagataaattagatttacaaaattgccctttcttgccattaatgaaaatg
ttacctgaggagttaaaagaactaagtattgaacttatacgaacagttcccggtactgtt
atagatgatattttgcctgataagctaaaaaaattaagtatcaacttttgtgataatatt
aaacttccagttaagcttcctgttaatttaaagtctatcaatttatcctcaaggacccct
attgcatgggaaataccaacctgcaatctgcctgcacatatagatattagtaccgatggt
tatgttaagcttaatcctgaatttcttaccaggagtgatattacctttagtaacaaacct
gcaggagatgtgttaagttttcagcctggagatgtggtttatggtttatgtaaggcaaga
gatcgagtaaatactttagttaattcgttatattatttttcaaaaaaagatattattatt
caaaatacattaacagatgcggtctgggacaggaagaatagagccgtgtttaataaagat
gagaagatagcagaaagattgaatgatgttcagagagggattttttttagagaattttta
tctcaacataaaaaatacaatattaccgaagataaatattcagacttatccaatgaggag
tgctggataaaaacaagtaaagccggtcttgaatttcaaacacgattgagggaacggtca
gttatttttgtcattgacaatttagttgatgctataagtgatatcgcaaataaaacagga
aagcatggtaattctattacagcacatgagctaagatgggtatatcggaatcgacatgat
gatctggtaaaacaaaatgttaaattttttcttaatggtgaggctatttcacacgaagat
gttttttcattagttggttgggataaatataagcctaaaaatagaaatcgttga

DBGET integrated database retrieval system