KEGG   Streptococcus thermophilus ND03: STND_0710Help
Entry
STND_0710         CDS       T01978                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
stn  Streptococcus thermophilus ND03
Brite
Enzymes [BR:stn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STND_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADQ62770
LinkDB All DBs
Structure
PDB: 

Position
684855..685517
Genome map
AA seq 220 aa AA seqDB search
MKALSLYGKMEKNEKRTFTMAIILPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANA
ALEKHPEIGEDLEALLADVEKIPADIRQALINNGGGHLNHALFWELLSPEKQEPTAEVAA
AINEAFGSFEAFQEVFTTAATTRFGSGWAWLVVNAEGKLEVVSTPNQDTPISDGKKPILA
LDVWEHAYYLKYRNVRPNYIKAFFEIINWNKVAELYAEAK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagctctatcactttatggtaagatggaaaaaaatgaaaagaggacctttactatg
gctattattcttccagatcttccttacgcttacgatgctttggaaccatacattgatgct
gaaacaatgactcttcatcatgacaaacaccatgcaacttacgtggcgaatgctaatgct
gcgcttgaaaaacaccctgaaattggtgaggaccttgaagcgcttttggctgatgtagaa
aaaattccagcagacattcgtcaagcacttattaacaatggtggtggacatcttaaccac
gcacttttctgggaacttttgtcaccagaaaaacaagaaccaactgcagaagtagcagcc
gctattaacgaagcattcggttcatttgaagctttccaagaagttttcactacggcagcg
acaactcgttttggttcagggtgggcatggcttgtggttaacgcagaaggtaaacttgaa
gttgtttcaactcccaaccaagatacacctatctcagacggtaaaaaaccaatcttggca
cttgatgtttgggaacatgcttactacctaaaataccgtaacgtacgtccaaactacatc
aaagccttctttgaaatcatcaattggaataaagttgctgagctttacgcagaagctaaa
taa

DBGET integrated database retrieval system