KEGG   Streptococcus thermophilus ND03: STND_0986Help
Entry
STND_0986         CDS       T01978                                 

Definition
(GenBank) Pyruvate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stn  Streptococcus thermophilus ND03
Pathway
stn00010  Glycolysis / Gluconeogenesis
stn00020  Citrate cycle (TCA cycle)
stn00620  Pyruvate metabolism
stn01100  Metabolic pathways
stn01110  Biosynthesis of secondary metabolites
stn01120  Microbial metabolism in diverse environments
stn01130  Biosynthesis of antibiotics
stn01200  Carbon metabolism
Module
stn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_0986
   00020 Citrate cycle (TCA cycle)
    STND_0986
   00620 Pyruvate metabolism
    STND_0986
Enzymes [BR:stn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STND_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADQ63036
LinkDB All DBs
Position
complement(937230..938618)
Genome map
AA seq 462 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKINMELEAEDSGVLLKIT
RQAGETVPVTEVIGYIGAEGEVVADNAAIAPAAEAAPQVEKVADVETPAAKPQPQVAIVH
EGGKIRATPKARKVAREMGIDIAQVLGTGAKGRIHADDVENFKGAQPKATPLARKIAADL
DIDLATVSGTGFGGKITKEDILAISAPAQVKVAAAAPAVEAKPEKVLPEGVEVIPMSAMR
KAISKGMTHSYLTAPTFTLNYDVDMTNLIALRKQVLDPIMNKTGMKVTFTDLIGLAVVRT
LMKEEHRYLNASLINDAQNIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQAGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGE
VVVRPIMGLCLTIDHRIVDGMNGAKFMVDLKHLLENPMELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagattattatgcctaagctcggtgtagacatgcaggaaggtgaaatcatc
gagtggaaaaaacaagagggagacgtggttaatgagggagatatccttcttgaaatcatg
tcagataagataaacatggaacttgaagcagaagactcaggtgttcttttgaagattacc
cgtcaagctggtgaaacagtaccagttactgaggtgattggttatatcggagctgaagga
gaagttgtggctgataatgctgcaatcgcaccagctgcagaagctgcgccacaagttgaa
aaagttgctgatgtggaaacgcctgctgctaagcctcagccacaggtagctattgttcat
gaaggtggcaaaatacgcgcgacacctaaagcacgtaaagtggcacgtgagatggggatt
gacatcgctcaagttctcggaactggggcaaaagggcgtattcatgcagatgatgttgag
aactttaagggcgctcaacctaaggcaacaccattggctcgcaagattgcagcagacctc
gatattgatttagctaccgtatctggaacaggatttggtggtaagattactaaggaagat
attcttgcaatcagtgctccagcacaagttaaggtggctgcagccgcacctgcggttgaa
gctaaacctgaaaaagtcttgccagaaggtgtggaagtcattccgatgtctgctatgcgt
aaggctatttctaagggaatgacgcactcatacttgactgcaccaacatttactcttaac
tatgatgtggacatgactaaccttatagctcttcgtaagcaagttcttgatccaatcatg
aataagactggtatgaaggtgaccttcactgatttgattggtttggcagttgtgcgtacc
cttatgaaagaggaacaccgttacctcaatgcatccttgattaatgatgcacaaaatatc
gaattacacaaatttgttaatcttggtattgcagttggtctagatgatggcttggttgta
ccagtcgttcatggtgctgataagatgagtttgtctgactttgtggtggcctctaaggat
gtcatcaaaaaagctcaggctggtaaattgaaggcggcagaaatgtcaggttctactttc
tctattactaacttgggaatgtttggaaccaagtcattcaatccaatcattaatcaacct
aactcagctatccttggtgtttcagcaactattcaaacaccggttgttgttgatggtgaa
gttgtcgtgcggccaatcatgggtctttgcttgactattgaccaccgtattgttgatggt
atgaatggtgctaaattcatggttgatttaaagcatttgcttgaaaatccaatggaattg
ttgatttaa

DBGET integrated database retrieval system