KEGG   Streptococcus thermophilus ND03: STND_1517Help
Entry
STND_1517         CDS       T01978                                 

Definition
(GenBank) D-alanine-D-alanine ligase-like ATP-grasp enzyme
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
stn  Streptococcus thermophilus ND03
Pathway
stn00473  D-Alanine metabolism
stn00550  Peptidoglycan biosynthesis
stn01100  Metabolic pathways
stn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    STND_1517
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STND_1517
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    STND_1517
Enzymes [BR:stn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     STND_1517
Peptidoglycan biosynthesis and degradation proteins [BR:stn01011]
 Precursor biosynthesis
  Amino acid ligase
   STND_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK MsyB
Motif
Other DBs
NCBI-ProteinID: ADQ63553
LinkDB All DBs
Position
complement(1432700..1433746)
Genome map
AA seq 348 aa AA seqDB search
MSKQTLILLYGGRSAEREVSVLSAESVMRAVDYNAFEVKTYFITQSGDFIKTQEFIETPG
DDEKLMTNDTVEASQAIKPSDIYEEDAVVFPVLHGPMGEDGSIQGFLETLKLPYVGTNVL
SSSVAMDKIMTKRILEVAGVPQVAYTGYIEGEDLEAAVAETLEKLTFPVFVKPANMGSSV
GISKAENESELRSAIDLALKYDSRILIEQGVVAREIEVGILGNTTVKTTDPGEVVKDVAF
YDYQAKYIDNKITMDIPARVPVEVMTQMRAYAAKAFRALGGCGLARCDFFLTEDGAIYLN
ELNTMPGFTQWSMYPLLWENMGLSYSDLIKELVVLGQEMFDKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaacccttatccttctctatggtggacgttcagcagaacgtgaagtgtct
gtactatcagctgagagtgttatgcgtgcggtagattacaacgcatttgaggttaaaacc
tactttatcactcagtctggtgattttatcaaaacacaagaatttatagaaaccccaggt
gatgatgagaagctcatgactaatgacactgttgaggctagtcaggctattaaaccaagc
gatatctacgaagaagatgctgtggtcttccctgtgcttcatggtcctatgggtgaggat
ggttctatccaaggtttccttgaaaccctcaagttgccatacgtggggaccaatgttctt
tcatcaagtgtagctatggacaagattatgaccaagcgtattcttgaagttgctggagtg
ccacaggttgcctacacaggctacatcgagggtgaagatttggaagcagcagtagcagag
acacttgaaaaattgaccttcccagtttttgtcaaaccagccaacatggggtcatctgtt
gggatttctaaagctgaaaatgaatcagagcttcgttcagcgattgatcttgctctcaaa
tatgatagccgtatcttgattgagcaaggtgtagttgctcgtgaaatcgaagttggtatc
cttggaaatacgactgtcaaaacgactgatccgggtgaagtggtcaaagacgtggctttc
tatgattaccaagccaagtacattgacaataagattaccatggatattccagctcgcgtg
cctgtcgaagtcatgacgcaaatgcgtgcctatgcggccaaggcctttcgtgctctaggg
ggttgcggtcttgcccgctgtgatttcttcctgacagaggatggagccatctaccttaat
gagctcaacaccatgccaggtttcactcaatggtcaatgtacccactactttgggaaaat
atgggactctcttactcagatcttatcaaggaattggtagttttgggacaagaaatgttc
gacaaacgtgaaagccatttgatttaa

DBGET integrated database retrieval system