KEGG   Streptococcus thermophilus ND03: STND_1527Help
Entry
STND_1527         CDS       T01978                                 

Definition
(GenBank) Anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
stn  Streptococcus thermophilus ND03
Pathway
stn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stn01100  Metabolic pathways
stn01110  Biosynthesis of secondary metabolites
stn01130  Biosynthesis of antibiotics
stn01230  Biosynthesis of amino acids
stn02024  Quorum sensing
Module
stn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STND_1527
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    STND_1527
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    STND_1527
Enzymes [BR:stn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     STND_1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ADQ63563
LinkDB All DBs
Position
complement(1441976..1443331)
Genome map
AA seq 451 aa AA seqDB search
MRKILPADTLTPILAYMRVQGEHKVILESIPREKENARFSIIAYNPVFEVTFKDGVLYEN
GKAIDQDPFEYLDQVTVKGIKSDLPFAGGAIGFAGYDMIGLYENIGEIPEDTIGTPDMHF
FIYESYLIFDHKKEKVYVVEDNIYSGRDNDAVRQALGQVVTILQTQAPNEFTPQALQALQ
FSNHIEKEVFMDMVAKAKKLIREGDMFQCVLSQRFSADFEGDPLDYYRNLRVTNPSNYLY
FYDFGDYQVIGASPESLVSVKNGEVFTNPIAGTRPRGANEDEDAALADELSHDVKETAEH
RMLVDLGRNDIGKIAKNGTVKVTKYMEVEYFRYVMHLTSVVKGQLLPELMSLDALKSTLP
AGTVSGAPKIRAMRRIYELEQEKRGIYAGAIGYLSATGDMDFAIAIRTMILKNQKAYVQA
GAGVVYDSVPENEFYETINKAKAMTRIGDVQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattttaccagccgataccttaacaccaatcttggcttatatgcgtgttcaa
ggggaacacaaggttatccttgaatctattcctcgtgagaaggaaaatgcacgtttttct
attattgcctacaatccggtctttgaagtaaccttcaaggatggtgttctttatgaaaat
ggtaaggcgattgatcaggatcctttcgaatacttggaccaagtaacagtcaagggcatc
aagtctgacctacctttcgcaggtggtgctatcggatttgcaggttatgatatgattggt
ctctatgaaaatatcggggagattcctgaagatacgattgggacacctgatatgcatttc
ttcatctatgagtcttatttgatttttgatcacaagaaggaaaaggtttatgtggttgag
gacaacatctactctggccgtgacaacgatgcggtgcgtcaagctcttggtcaggtggta
acgatcctacagactcaggcgccaaacgagtttacacctcaggccttgcaagctttgcaa
ttttcgaatcatatcgaaaaagaggtcttcatggatatggtggctaaggctaagaaactc
attcgtgagggagatatgttccaatgtgtgcttagtcaacgcttttcagcggactttgag
ggagatcctttggattactaccgtaacttgcgcgtgaccaacccatcaaactacctttat
ttctatgatttcggagattatcaggtgattggtgccagcccagagagcctggtttcagtg
aaaaatggagaggtgttcaccaatccgattgctggaactcgccctcgtggtgccaatgag
gatgaagatgctgccttggcggatgaactctcacatgatgttaaagaaactgcggaacac
cgtatgttggttgacttgggacgtaatgatattggtaagattgccaaaaatggtacggtc
aaggtgaccaagtatatggaggttgagtattttcgctatgtgatgcaccttactagtgtg
gttaaggggcaactcttaccggagttgatgtcccttgatgctctaaaatcaactctacca
gctggaaccgtgtcaggagcacctaagattcgtgctatgcgtcgtatctatgagcttgag
caggaaaaacgtggtatttatgcgggagctattggttatctgtctgcgacaggagatatg
gactttgccattgctatccgtactatgattctcaaaaatcaaaaagcctatgttcaggca
ggtgcaggtgttgtctatgacagtgttcctgaaaatgaattttatgaaacgattaataag
gcgaaagctatgacaagaataggagatgtccaatga

DBGET integrated database retrieval system