KEGG   Streptococcus thermophilus ND03: STND_1571Help
Entry
STND_1571         CDS       T01978                                 

Definition
(GenBank) Aspartate aminotransferase, putative
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
stn  Streptococcus thermophilus ND03
Pathway
stn00220  Arginine biosynthesis
stn00250  Alanine, aspartate and glutamate metabolism
stn00290  Valine, leucine and isoleucine biosynthesis
stn01100  Metabolic pathways
stn01110  Biosynthesis of secondary metabolites
stn01130  Biosynthesis of antibiotics
stn01210  2-Oxocarboxylic acid metabolism
stn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STND_1571
   00290 Valine, leucine and isoleucine biosynthesis
    STND_1571
   00220 Arginine biosynthesis
    STND_1571
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stn01007]
    STND_1571
Enzymes [BR:stn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     STND_1571
    2.6.1.66  valine---pyruvate transaminase
     STND_1571
Amino acid related enzymes [BR:stn01007]
 Aminotransferase (transaminase)
  Class I
   STND_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADQ63606
LinkDB All DBs
Position
complement(1480655..1481869)
Genome map
AA seq 404 aa AA seqDB search
MKTFDKSSKLEHVAYDIRGPVLDEANRMIAKGEKILRLNTGNPAEFGFTAPDEVIRDLIM
NVRNSEGYSDSKGIFSARKAIMQYCQLKGFPNVDIDDIYIGNGVSEMIPMSMQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYVCDEKSNWYPDIDDIKSKITSNTKAIVIINPNNP
TGALYPKDVLEQIVDIARQNDLIIFADEIYDRLVMDGKKHIAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKKNVRGYIEGLDMLSNMRLCSNVLSQHVIQTSLGGYQSVDELL
IPGGRIYEQREFITNTVNDIPGLTAVKPDAGLYIFPKIDRNMYDIDDDEEFCLRLLKKEK
VLLVPGKGFNWNEPDHFRIVYLPRVEELADLGNKIERVLSYYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttgataaatcatcaaagttggaacacgttgcctatgatattcgtggtcca
gttttggatgaggccaaccgtatgattgccaaaggtgaaaaaattctccgtctgaacaca
ggaaatcctgcggaatttggttttacagcaccagatgaagtcattcgtgacttaattatg
aatgttcgtaacagtgaggggtattcagatagtaaggggattttctcagctcgtaaggct
attatgcagtattgccagcttaagggtttcccaaatgtagacatcgatgatatctatatt
ggtaacggtgtgtcagagatgattcccatgtctatgcaggccttgcttgatgatggtgat
gaagtcttggttccaatgccagactatcctctttggactgcttgtgtcagtctagctggc
ggtaacgctgttcactatgtctgtgatgaaaaatctaactggtatccagacattgatgat
atcaaatcaaagattacatcaaatactaaggctattgttattatcaatccgaataacccg
acaggtgctctttaccctaaagatgttcttgaacagattgtcgatattgcacgccaaaat
gatttgattatctttgcggatgagatttatgaccgcttggttatggatggtaagaagcac
attgctattgcaagtcttgcaccagacgttttctgtgtatctatgaatggtctttctaaa
tctcaccgtatttgtggtttccgtgtaggttggatggttctttctgggcctaagaagaat
gttcggggctatattgaagggcttgatatgttgtccaatatgcgcctttgctctaatgtg
ctctctcaacacgtaattcagacctcacttgggggctaccaatctgttgatgagctcctg
attccaggtggtcgtatttatgaacaacgtgagtttattacaaacacagtaaacgatatt
ccaggactcacagctgttaagccagatgcgggtctttacatcttccctaagattgaccgc
aacatgtatgatattgacgatgatgaagagttctgccttcgtcttttgaagaaggaaaag
gtcctcttggttccaggtaaaggctttaactggaatgaaccggaccacttccgtattgtc
taccttcctcgtgtggaagaattggctgatcttggaaataaaatcgagcgtgttttgtca
tattataagcgctaa

DBGET integrated database retrieval system