Sulfurisphaera tokodaii: STK_13448 Help Entry STK_13448         CDS       T00062                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism sto  Sulfurisphaera tokodaii Brite KEGG Orthology (KO) [BR:sto00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sto03036]     STK_13448 Chromosome and associated proteins [BR:sto03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     STK_13448 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA CENP-H SlyX COG3_N DivIC Vinculin Speriolin_N HMMR_N DUF3450 TSC22 GOLGA2L5 bZIP_1 CCDC22_CC Fez1 DUF4201 DUF4795 HAP1_N DUF3375 ERM_helical DUF948 DUF648 RmuC GIT_CC FAM76 DUF6262 Taxilin CASP_C Spc24 FlaC_arch Transglut_core2 CTU2 SecA_DEAD V_ATPase_I Sec8_N Mis12 XRCC4 BRE1 DUF2203 Sec20 DUF5082 APG6_N DUF3573 SKA2 Exonuc_VII_L Synaptobrevin DUF724 TMF_TATA_bd Motif Other DBs NCBI-ProteinID:  BAB66407 UniProt:  Q971L3 LinkDB All DBs Position 1353727..1354023 Genome browser AA seq 98 aa AA seqDB search MTINEVYQQLDELQLKYSKAIDTITKLQNKIARLQRENEQLKEQNRELLEENKKLRKLNN ILYKAMEIAVNIENPEAQTRHLKKVLEKLREETREFKG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacgatcaatgaagtctatcagcaactagatgagctgcagctcaagtacagcaaagct attgacactattacaaagctgcagaataagatagcgagacttcagagagagaacgaacag ctaaaagaacaaaacagagagctcttagaggaaaataaaaagcttaggaaactaaataat atattgtacaaggcaatggagatagcagtaaacatagagaaccctgaagctcaaactagg catctcaaaaaagtgttagaaaagttgagagaggaaactagggagtttaaggggtga

DBGET integrated database retrieval system