KEGG   Sulfolobus tokodaii: STK_21010Help
Entry
STK_21010         CDS       T00062                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sto  Sulfolobus tokodaii
Pathway
sto00620  Pyruvate metabolism
sto00680  Methane metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STK_21010 (ppc)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_21010 (ppc)
   00680 Methane metabolism
    STK_21010 (ppc)
Enzymes [BR:sto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     STK_21010 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 DASH_Dad1
Motif
Other DBs
NCBI-ProteinID: BAB67205
UniProt: Q96YS2
LinkDB All DBs
Position
complement(2109090..2110625)
Genome map
AA seq 511 aa AA seqDB search
MRKIPRTMSTQHPDNARVPEWSRSEVISGESEVIEAYLAYEHYEVDEVMWDAEGKDVDTH
VVRKLLTQYPEFFKEKILGRDIFLTYRIPNPKIEGAEKKVFAETMESIPITYDLAEKFFN
TKPTPPVFEVILPFTTDYKELIAILKYYEVAIVNKENVKLVDDIYVKDLIGEINPKSIEI
IPLIEDRDSMFKIDQIVGEYIKAMKPPYMRVFLARSDPAMNYGLISAVLSVKYALNRLGK
IEKKYGIKIFPLIGVGSLPFRGHFNPMNFEKVIDEYRGVYTFTVQSAFKYDYEDNEVINA
IRKINEREISEFELLDEEEEKILHRIANVYTSSYQPIIESLADVINKIALFLPRRRARKL
HIGLFGYSRSTGKVTLPRAITFTGALYSIGIPPELIGISSLSTLTEKEWNVLEKNYKYIK
HDLQAAARFVSYESIDLMKETWNVNEEIIKKIMEDLSYAENTLNIKIGDSNSVGRKHALI
SSLALIALKEGNIDEAKSYLLEMAKIRKSLG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatacctaggactatgtcaacccaacatccagataatgcgagagtaccagag
tggagtagaagcgaagttattagtggtgaaagtgaagttattgaggcttatttagcttat
gagcattatgaagtagatgaggttatgtgggatgctgaaggaaaagatgttgacactcat
gtagtgagaaaacttctaacacagtatcctgaattttttaaagagaagatcttaggtaga
gacatattccttacctataggatacctaatccaaaaattgaaggagcagaaaagaaagta
tttgctgagacaatggaaagtattccaattacttatgatctggccgaaaagttctttaat
actaaacctacaccaccagtgtttgaggtgattttaccttttacaacagattataaagaa
ttaattgctattttaaaatattatgaagttgctatagtgaataaagagaatgtaaaatta
gttgatgacatctatgtaaaagatctaattggtgagataaatcctaaaagtatcgaaatt
attcctttgatcgaagatagggattctatgtttaagattgaccaaatagtaggtgaatat
attaaagcaatgaaaccgccttatatgagagtattcttagctagatctgatcctgcaatg
aattatggtcttatttcagctgtattatctgtaaaatatgctttgaacagactaggtaag
atcgagaaaaaatatggtatcaaaatatttcctttaataggagtaggttcattgccgttt
agagggcattttaatcctatgaactttgaaaaagtaatagatgaatataggggagtttat
acctttacagtgcaatctgcttttaaatatgattatgaggataatgaagttattaatgct
attagaaagattaatgagagagaaatatctgaatttgaattattagatgaggaagaagaa
aagatattacatagaatagctaacgtatatacttcttcgtatcaacctataatagaaagt
ttagcagatgtaataaataaaatagcattatttttgcctagaagaagagcaagaaaatta
catataggtttgtttggttattctaggagcacgggtaaagtcactttaccaagagcaata
acgttcactggtgcattatattcaattggtatacctccagaactcataggtatatcttca
ttgtctactcttactgaaaaagaatggaatgtattagagaaaaattataaatatattaaa
catgatcttcaagctgctgctaggtttgtaagttatgaatcaatagacttaatgaaagag
acttggaacgtgaatgaagaaatcataaagaaaattatggaagatttgtcatatgcagaa
aatactcttaatattaaaataggtgactcaaactctgtgggtagaaaacatgcattaata
tccagtttagcactaatagcattaaaagagggtaacatcgatgaagctaagagttacctt
ttagaaatggcaaaaataagaaaatcattaggatga

DBGET integrated database retrieval system