KEGG   Salinispora tropica: Strop_0493Help
Entry
Strop_0493        CDS       T00504                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
stp  Salinispora tropica
Pathway
stp00564  Glycerophospholipid metabolism
stp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Strop_0493
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Strop_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8 Pyr_redox GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABP52978
UniProt: A4X278
LinkDB All DBs
Position
complement(570421..572145)
Genome map
AA seq 574 aa AA seqDB search
MHSATLSLATRERSLAALSSGLELDVLVIGGGVTGAGCALDAVTRGLSVGLVEARDWASG
TSSRSSKLIHGGLRYLEMLDFGLVREALRERGLLLQRLAPHLVRPVPFLYPLRHRGWERL
YAGAGVLLYDTMSYSGSNSRGVPAHRHLTRRGAVRACPSLRPESLVGALQYYDAQVDDAR
LVTCLVRTAAAHGAYPVSRARVVGLLRDGHRVTGARVHDLETDQVFEIRARQVINATGVW
TDDIQSLVDEPGPVQVRASKGIHLVVPRDRIHSTTGLILRTESSVLFVIPWGRHWLIGTT
DSDWDLDKAHPAATSRDIDYLLERVNEVLATPLTRDDVEGVYAGLRPLLSGQSDATAKLS
REHTVASSMPGLVMVAGGKYTTYRVMARDAVDEAVRGLGGGVPRSCTDQVPLHGAEGYVA
RWNQRRRIARQYGLTVERVEHLLRRYGAAVDEVLHLLREDPTLVEPLDGTDDYLRVEVVH
AVSAEGALHLEDVLTRRTHVSIETFDRGLAAARPAAQLMAPVLGWDAERTDREVAHYVAQ
VDAERIAHDQIDDQAADAARLVVPDVVPQVALAA
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcactccgcgacactgtcactggccacccgcgagcggtccctggccgcactgagcagc
ggcctggaactggacgtcctggtgatcggcggcggcgtcaccggcgccggctgcgccctt
gacgccgtcactcggggcctgtcggtcggcctcgtcgaggcccgcgactgggccagcggc
acatcgagccgttccagtaagctcatccacggcggtctgcgctacctggagatgctcgac
ttcgggctggtccgcgaggcgctgcgcgagcggggcctcctcctgcagcgactcgccccg
cacctggtccggccggtgccgtttctctacccgctgcgacaccgcggctgggaacgactg
tacgcgggcgccggcgtcctgctctacgacacgatgagctattccggcagcaattcccgc
ggggtaccggcccaccggcacctgacccgacgtggcgcggtacgcgcttgcccgtccctg
cgtccggagtcgctggtcggcgccttgcagtactacgatgcccaggtcgatgacgcccgg
ctggtgacgtgtcttgtccgtaccgccgcagcccacggcgcgtatcccgtttcccgagcc
cgggtcgtgggcctcctgcgtgacggccaccgcgtcaccggcgcgcgggtccacgacctg
gagaccgaccaggtcttcgagatccgtgcccggcaggtcattaacgccaccggagtctgg
accgacgatatccagtctctcgttgatgagcctgggccggtgcaggttcgggcttcgaag
ggtattcacctcgtcgtaccccgcgaccggatccactccaccaccggcctgatcctgcga
accgaatccagcgtgctgttcgtgatcccgtggggtcggcactggctgatcggcaccacc
gacagcgactgggatctggacaaggcgcacccggcagcgaccagccgcgacatcgactac
ctgctggaacgggtcaacgaggtactggccactccgctgacccgcgacgacgtcgagggc
gtgtacgcgggtctgcgcccgctgctgtccgggcagtcggatgcgactgccaagttgtcc
cgtgagcacacggtggccagttcgatgccgggtctggtgatggtcgccggcgggaagtac
acaacgtatcgggtgatggcccgggacgctgtcgatgaggccgtgcggggactcggtggt
ggggtgccgcggtcctgcaccgaccaggttcccctgcacggcgccgagggctatgtcgcc
cgatggaaccagcgccgtcgcatcgcgcgacagtacggcctgaccgtggagcgggtcgag
catctcctgcgtcgctacggggccgccgtcgacgaggtgctgcacctgctccgagaggat
ccgaccctcgtcgagccgctcgacggcaccgacgactatctgcgtgtggaggtcgttcac
gcggtgtcggccgagggcgccctgcacctggaggacgtactcacccggcgtacacacgtc
tcgattgagacgttcgaccggggcctggcagcggcccgcccggcagcgcagttgatggca
ccggtgctcggctgggacgccgagcgtacggaccgcgaggtggcgcactatgtcgcgcag
gtggacgccgaacggattgcgcacgaccagattgacgaccaggccgccgacgcggcccgg
ctggtcgtgccggatgtggtgccgcaggtagcactcgcggcctga

DBGET integrated database retrieval system