KEGG   Salinispora tropica: Strop_1543Help
Entry
Strop_1543        CDS       T00504                                 

Definition
(GenBank) DNA primase, small subunit
Organism
stp  Salinispora tropica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABP54009
UniProt: A4X559
LinkDB All DBs
Position
1752252..1753277
Genome map
AA seq 341 aa AA seqDB search
MGGTKAAAEEIKVAGQHVRLSSPDRVIFPQRGFTKADVFHYYLAVGPGIMRALGERPTTL
QRFPEGIEGEAFFQKRVPARGVPPWVRTAQISFPSGRKAAELCPADLAHVAWAAQMGTVV
FHPWPVRATDPDHPDELRLDLDPQPGTDFADAAKAATELRAILAELGVPGWPKTSGGRGV
HVYLRIQPRWTFVEVRRATIALARELERRRPDLVTTAWWKEERGARVFVDFNQMARDRTI
ACAYSLRANARATVSTPLAWDELADAEPDDFDLRSVPARLAEGGDPHAGIDDAAWDITPL
LEWVERDAANGQGDLPYPPEHPKMPGEPKRVQPSKDRDRPR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcacgaaggccgcggccgaggagatcaaggtcgccgggcagcacgtccggctg
agtagcccggaccgggtgatttttccacaacgcgggttcaccaaggccgacgtcttccac
tactacctcgccgtcggcccgggcatcatgcgtgcactcggcgagcggccgaccaccctg
caacgcttccccgaggggatcgagggggaggccttcttccagaaacgggtgcccgcccgg
ggtgtgccgccctgggtccgtaccgcgcagatcagcttccccagtggccggaaagcggcc
gagctctgcccggctgatctggcccacgtggcctgggcagcccagatgggcaccgtggtc
ttccatccgtggccggtccgtgccacggatccggaccaccccgacgagctgcggctcgac
ctcgacccgcagcccggtaccgacttcgccgacgcggcgaaagcggcgaccgagctccgc
gcgatcctggctgagctgggcgtccccggttggccgaagacctccggcggccggggggtg
cacgtctatctgcggatccagccgcgctggaccttcgtcgaggtccgtcgggcgaccatt
gccctggcccgggagttggagcggcgccgacccgacctggtcaccaccgcgtggtggaag
gaggaacgcggcgcccgggtattcgtcgacttcaaccagatggcccgggaccggacgatc
gcgtgtgcgtactcgctgcgggccaacgcccgcgccaccgtctccaccccactggcctgg
gacgaactggccgacgctgaaccggacgacttcgacctgcggagcgtgccggcacggctg
gccgagggcggtgacccacacgccggcatcgacgacgccgcgtgggacatcacgcccctg
ctggagtgggtcgagcgggacgccgccaacgggcagggtgacctgccatacccgccggaa
caccccaagatgcccggtgagccgaagcgggtgcagccgtcgaaggatcgagaccgcccc
cgctga

DBGET integrated database retrieval system