KEGG   Salinispora tropica: Strop_1546Help
Entry
Strop_1546        CDS       T00504                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
stp  Salinispora tropica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase HTH_28 LZ_Tnp_IS481
Motif
Other DBs
NCBI-ProteinID: ABP54012
UniProt: A4X562
LinkDB All DBs
Position
complement(1755385..1756494)
Genome map
AA seq 369 aa AA seqDB search
MKLPISPPVEPMLAKSVPRIPTADGMTYEPKWDGFRCIVFRDGEEVELASRGGKLMTRYF
PEVVEQARRQLPERCVVDGELIVIQRDRPDGQPQLNFELLAQRIHPAASRVRLLAETTPA
DFVAFDLLALADESLLDQPYPHRRSRLEAALGHVAPPMHVTQVTTDPATARRWFDRFEGA
GLDGLIAKPAELPYEPGKRLMFKVKHKRTVDVVVAGFRWHKSGPVVGSLLLGLYDDAGVL
HHVGVSASFPMARRKELLDELEPYRGAGADHPWVHGDHERGQRIPGGVSRWTGGKNLEWE
PLRPELVVEVSYDAMEGDRFRHTAQFVRWRPDRKPRSCRYDQLDRPVRFDVDQVLRGDPE
NGGPTSGPA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgccgatcagtccgccggtcgagccgatgctcgccaagagcgtcccacggatc
ccgaccgcggacgggatgacctacgagccgaagtgggacggcttccggtgcatcgtgttc
cgcgacggcgaggaggtcgagctggccagccggggcggcaagctgatgacgcgttacttc
cccgaggtggtcgagcaggcccgccggcagctgcccgagcgctgcgtggtcgacggcgag
ttgatcgtgatccagcgcgatcggccggatgggcagccccagctcaacttcgagttgctg
gcccagcgcatccacccggccgcctcccgggtgcgcctgctcgccgaaaccaccccggcg
gacttcgtggcgttcgacctgctcgccctcgccgacgagtccctcctcgaccagccgtac
ccacatcgacggtcccgactggaggcggcgttggggcacgtcgcgccaccgatgcacgtc
acccaggtcaccaccgacccggccaccgcgcgccgctggttcgaccggttcgagggggcg
gggttggacggcctgatcgccaaacccgccgagctgccgtacgagccgggcaaacgcctg
atgttcaaggtcaagcacaaacggaccgtcgatgtcgtggtggcgggctttcgctggcac
aagtccggcccggtggtcggctcacttctgctcgggctctacgacgacgccggcgtcctg
catcatgtgggggtgagcgcgtcgttccccatggcccgccggaaagagctgttggacgag
ttggagccataccggggcgccggggccgaccatccctgggtgcacggcgaccacgaacgc
ggtcagcgcatcccgggcggggtcagccggtggaccggcgggaagaacctggagtgggag
ccgctgcggccggagctggtggtcgaggtgagctacgacgcgatggagggcgaccggttc
cgacacaccgcccagttcgtccggtggcgcccggaccgcaagccccgttcctgccgttac
gaccagctcgaccgtccggtccggttcgacgtggatcaggtgctccgaggcgacccggag
aacggtggtcccacgtccgggccggcgtag

DBGET integrated database retrieval system